Property Summary

Ligand Count 3
NCBI Gene PubMed Count 47
PubMed Score 584.18
PubTator Score 148.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 25 0.0 4.0

Expression

  Differential Expression (20)

Disease log2 FC p
Barrett's esophagus 1.100 2.4e-02
Breast cancer 3.100 2.2e-02
gastric cancer 1.200 4.1e-03
group 3 medulloblastoma 1.100 8.9e-03
hepatocellular carcinoma 1.200 2.4e-04
intraductal papillary-mucinous adenoma (... 1.400 2.9e-04
intraductal papillary-mucinous carcinoma... 1.400 4.7e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.7e-02
invasive ductal carcinoma 1.100 1.8e-02
juvenile dermatomyositis 1.797 9.1e-09
lung adenocarcinoma 1.356 1.6e-08
lung carcinoma 1.100 2.3e-16
non-small cell lung cancer 1.300 6.8e-15
osteosarcoma 2.315 1.2e-06
ovarian cancer 2.800 8.1e-05
pancreatic cancer 1.500 1.2e-02
pancreatic carcinoma 1.500 1.2e-02
psoriasis 1.300 2.1e-03
tuberculosis -1.700 2.0e-05
X-linked cerebral adrenoleukodystrophy 1.400 4.7e-02

Gene RIF (31)

AA Sequence

MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKIQLIKKKGKVKALD      1 - 70
EEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKG     71 - 140
YDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLLIG    141 - 210
VRSEHKLSTDHIPILYRTARTQIGSKFTRWGSQGERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASD    211 - 280
ASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQ    281 - 350
PESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELAS    351 - 420
DFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGV    421 - 490
ASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLI    491 - 560
MGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVAR    561 - 630
QGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE     631 - 699
//

Text Mined References (57)

PMID Year Title