Property Summary

NCBI Gene PubMed Count 12
Grant Count 11
R01 Count 5
Funding $1,983,398.5
PubMed Score 55.87
PubTator Score 46.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 0.000
medulloblastoma, large-cell 1.200 0.001
non-small cell lung cancer 1.981 0.000
lung cancer 3.200 0.000
colon cancer 1.300 0.002
lung adenocarcinoma 1.200 0.000
nasopharyngeal carcinoma 1.300 0.000
invasive ductal carcinoma 1.300 0.004

 GO Component (1)

Gene RIF (1)

PMID Text
26140362 purine biosynthetic pathway enzymes PPAT and PAICS, as well as pyruvate kinase activity are increased in lung cancer

AA Sequence

MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPTFKSHKGMGLV      1 - 70
NHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGI     71 - 140
GLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGR    141 - 210
LIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFC    211 - 280
IFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKN    281 - 350
RYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP    351 - 420
PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQEN    421 - 490
GNGLECFEKSGHCTACLTGKYPVELEW                                               491 - 517
//

Text Mined References (14)

PMID Year Title
26140362 2015 Role and regulation of coordinately expressed de novo purine biosynthetic enzymes PPAT and PAICS in lung cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10597272 1999 Growth factor-regulated expression of enzymes involved in nucleotide biosynthesis: a novel mechanism of growth factor action.
10593947 1999 Interdomain signaling in glutamine phosphoribosylpyrophosphate amidotransferase.
9108165 1997 Role of NRF-1 in bidirectional transcription of the human GPAT-AIRC purine biosynthesis locus.
8380692 1993 Molecular cloning of human amidophosphoribosyltransferase.
More...