Property Summary

Ligand Count 1
NCBI Gene PubMed Count 12
PubMed Score 56.14
PubTator Score 46.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer 1.300 2.0e-03
invasive ductal carcinoma 1.300 3.9e-03
lung adenocarcinoma 1.200 4.1e-13
lung cancer 2.400 9.4e-04
medulloblastoma, large-cell 1.200 7.6e-04
nasopharyngeal carcinoma 1.300 1.6e-04
non-small cell lung cancer 1.981 4.3e-26
psoriasis -1.200 2.8e-04

 GO Component (1)

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPTFKSHKGMGLV      1 - 70
NHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGI     71 - 140
GLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGR    141 - 210
LIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFC    211 - 280
IFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKN    281 - 350
RYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP    351 - 420
PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQEN    421 - 490
GNGLECFEKSGHCTACLTGKYPVELEW                                               491 - 517
//

Text Mined References (14)

PMID Year Title