Property Summary

NCBI Gene PubMed Count 24
PubMed Score 14.49
PubTator Score 22.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis -1.225 3.8e-02
atypical teratoid / rhabdoid tumor 1.300 1.6e-04
colon cancer -2.100 1.8e-02
cutaneous lupus erythematosus -1.200 3.4e-02
gastric carcinoma -1.300 1.7e-02
group 4 medulloblastoma 1.400 8.2e-05
lung cancer -2.300 3.2e-04
malignant mesothelioma -1.800 8.3e-07
non-small cell lung cancer 1.199 5.6e-12
osteosarcoma 2.729 2.6e-07
primitive neuroectodermal tumor 1.100 2.7e-02
psoriasis -2.300 1.1e-05
spina bifida -1.001 3.9e-02

Protein-protein Interaction (10)

Gene RIF (16)

AA Sequence

MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPVSQFKDADLNS      1 - 70
MFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFASGKIKEFSFEKLKNSNHAAY     71 - 140
RKGRKVKSDSFNRRSVDLDLLCGHYNNDGNAPSFGLLRSSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDL    141 - 210
VTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMN    211 - 280
VMTRLASYLKKLPFEFMQSGNNEALDLTELISNMPSLQLTPFSPVFGTEQPPKYEDVVQLSASDSGRFQT    281 - 350
IELQNDKPNSRKMDTVQSIPNNSTNSLYNLEVNDPRTLKAVQVQSQSLTMNPLENVSSDDLMETLYIEEE    351 - 420
SDGKKALDKGQKTENGPSHELLKVNEHRAEFPEHATHLKKCPTPMQNEIGKIFEKSFVNLPKEDCKSKVS    421 - 490
KFEEGDQRDFTNSSSQEEIDKLLMDLESFSQKMETSLREPLAKGKNSNFLNSHSQLTGQTLVDLEPKSKV    491 - 560
SSPIEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIEDFAQELVECKSSRGSLSQEKEMMQILQETLT    561 - 630
TSSQANLSVCRSPVGDKAKDTTSAVLIQQTPEVIKIQNKPEKKPGTPLPPPATSPSSPRPLSPVPHVNNV    631 - 700
VNAPLSINIPRFYFPEGLPDTCSNHEQTLSRIETAFMDIEEQKADIYEMGKIAKVCGCPLYWKAPMFRAA    701 - 770
GGEKTGFVTAQSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPE    771 - 840
FHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWEL    841 - 910
DTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYADFVWFLISEEDKRNPTSIEYW    911 - 980
FRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHI    981 - 1050
FYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPA   1051 - 1120
SPSEFGNKSNKILSASLPEKCGKLQSVDEE                                           1121 - 1150
//

Text Mined References (26)

PMID Year Title