Property Summary

NCBI Gene PubMed Count 229
Grant Count 331
R01 Count 217
Funding $38,481,526.42
PubMed Score 1061.82
PubTator Score 758.08

Knowledge Summary

Patent (163,605)

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 0.025
psoriasis -1.200 0.001
osteosarcoma -3.078 0.000
tuberculosis 1.600 0.000
non-small cell lung cancer -1.531 0.000
lung cancer -1.500 0.001
interstitial cystitis 1.600 0.008
primary Sjogren syndrome 1.100 0.025
subependymal giant cell astrocytoma 1.182 0.025
lung carcinoma -2.200 0.000
ulcerative colitis 1.100 0.005

Synonym

Accession Q06187 B2RAW1 Q32ML5
Symbols AT
ATK
BPK
XLA
IMD1
AGMX1
PSCTK1

Gene

BTK

PDB

1AWW   1AWX   1B55   1BTK   1BWN   1K2P   1QLY   2GE9   2Z0P   3GEN   3K54   3OCS   3OCT   3P08   3PIX   3PIY   3PIZ   3PJ1   3PJ2   3PJ3   4NWM   4OT5   4OT6   4OTF   4OTQ   4OTR   4RFY   4RFZ   4RG0   4RX5   4YHF   4Z3V   4ZLY   4ZLZ   5BPY   5BQ0   5FBN   5FBO   5JRS   5KUP  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (121)

PMID Text
26540570 Data show that Bruton tyrosine kinase (BTK)inhibitor Ibrutinib augments MALT lymphoma associated translocation protein (MALT1) inhibition by S-Mepazine in CD79 antigen mutant activated B cell-subtype (ABC) of diffuse large B cell lymphoma (DLBCL).
26475492 FcgammaRIIB requires Btk and p38 MAPK to mediate antigen-independent inhibition in human B cells.
26387629 Data indicate that the X linked agammaglobulinemia (XLA) diagnosis was confirmed for six patients with six different mutations.
26383180 BTK-C is a survival factor in prostate cancer cells.
26292723 BTK RNA interference inhibits proliferation of FLT3-ITD acute myeloid leukemia cells.
26182170 Letter: report BTK inhibitor ibrutinib induced panniculitis in lymphoid leukemia patients.
26089373 Activates PKC independent of BTK.
26059659 study indicates that BTK is essential for NLRP3 inflammasome activation and could be a potent therapeutic target in ischaemic stroke
26036311 We found that chemoresistance was dependent on Btk and JAK2/STAT3, which maintained CSC by inducing Sox-2 and prosurvival genes. We suggest that addition of ibrutinib to cisplatin may improve treatment outcome in ovarian cancer.
25944695 Data show that Bruton tyrosine kinase (Btk) inhibitor PLS-123 suggested a new direction to pharmacologically modulate Btk function and develop novel therapeutic drug for B-cell lymphoma treatment.
More...

AA Sequence

MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPE      1 - 70
KNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQ     71 - 140
KYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAP    141 - 210
VSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYE    211 - 280
WYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKH    281 - 350
LFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK    351 - 420
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMR    421 - 490
HRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFP    491 - 560
VRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIM    561 - 630
YSCWHEKADERPTFKILLSNILDVMDEES                                             631 - 659
//

Text Mined References (243)

PMID Year Title
26540570 2015 Combinatorial BTK and MALT1 inhibition augments killing of CD79 mutant diffuse large B cell lymphoma.
26475492 2015 Fc?RIIB mediates antigen-independent inhibition on human B lymphocytes through Btk and p38 MAPK.
26387629 2015 Prevalence of BTK mutations in male Algerian patterns with agammaglobulinemia and severe B cell lymphopenia.
26383180 2015 Bruton's tyrosine kinase is a potential therapeutic target in prostate cancer.
26292723 2015 Targeting BTK for the treatment of FLT3-ITD mutated acute myeloid leukemia.
26182170 2015 Panniculitis in Patients Undergoing Treatment With the Bruton Tyrosine Kinase Inhibitor Ibrutinib for Lymphoid Leukemias.
26089373 2015 Treatment with Ibrutinib Inhibits BTK- and VLA-4-Dependent Adhesion of Chronic Lymphocytic Leukemia Cells In Vivo.
26059659 2015 Bruton's tyrosine kinase is essential for NLRP3 inflammasome activation and contributes to ischaemic brain injury.
26036311 2015 Bruton's tyrosine kinase (Btk) inhibitor ibrutinib suppresses stem-like traits in ovarian cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...