Property Summary

Ligand Count 356
NCBI Gene PubMed Count 248
PubMed Score 1199.46
PubTator Score 758.08

Knowledge Summary

Patent (163,605)

TINX Plot

  Disease (8)

Disease Target Count
Arthritis 290
Abnormality of the tonsils 10
Arthritis, Infectious 3
Cellulitis 20
Chronic diarrhea 29
Chronic otitis media 52
Congenital deafness 185
Conjunctivitis 53
Conjunctivitis, recurrent 37
Cor pulmonale 6
Deafness 198
Delayed bone age 136
Delayed speech and language development 112
Diarrhea 253
Encephalitis 64
Enteroviral dermatomyositis syndrome 1
Enteroviral hepatitis 1
Epididymitis 8
Exanthema 43
Failure to gain weight 365
Fatigue 182
Fever 138
Glossoptosis 10
Hearing Loss, Partial 185
Hypocalcemia 32
Immunologic Deficiency Syndromes 113
Increased susceptibility to bacterial infections 42
Infected joint 1
Infectious disease of lung 29
Isolated somatotropin deficiency 30
Language Delay 112
Lymph node hypoplasia 2
Meningitis 67
Multiple pulmonary infections 29
Neutrophil count decreased 47
Otitis Media 52
Panhypogammaglobulinemia 9
Paranasal Sinus Diseases 34
Pediatric failure to thrive 365
Pneumonia 174
Posterior displacement of the tongue 10
Prone to bacterial infection 42
Prostatitis 18
Pyoderma 4
Recurrent bacterial infection 42
Recurrent cutaneous abscess formation 4
Recurrent enteroviral infections 2
Recurrent pneumonia 29
Recurrent pulmonary infections 29
Recurrent urinary tract infection 24
Sensorineural Hearing Loss (disorder) 284
Septicemia 6
Short stature 531
Sinusitis 65
Skin Diseases, Bacterial 7
Skin Ulcer 48
Small lymph nodes 2
Speech Delay 112
Speech impairment 112
X- linked recessive 110
X-linked agammaglobulinemia 7
X-linked agammaglobulinemia with growth hormone deficiency 2
ear infection chronic 52
hearing impairment 199
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Isolated growth hormone deficiency 30 0.0 5.0

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 2.5e-02
interstitial cystitis 1.600 8.2e-03
lung cancer -1.500 1.3e-03
lung carcinoma -2.200 4.4e-26
non-small cell lung cancer -1.531 3.5e-20
osteosarcoma -3.078 7.9e-06
primary Sjogren syndrome 1.100 2.5e-02
psoriasis -1.200 8.0e-04
subependymal giant cell astrocytoma 1.182 2.5e-02
tuberculosis 1.600 9.1e-08
ulcerative colitis 1.100 5.2e-03

Protein-protein Interaction (9)

Gene RIF (139)

AA Sequence

MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPE      1 - 70
KNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQ     71 - 140
KYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAP    141 - 210
VSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYE    211 - 280
WYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKH    281 - 350
LFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK    351 - 420
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMR    421 - 490
HRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFP    491 - 560
VRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIM    561 - 630
YSCWHEKADERPTFKILLSNILDVMDEES                                             631 - 659
//

Text Mined References (262)

PMID Year Title