Property Summary

NCBI Gene PubMed Count 48
PubMed Score 412.97
PubTator Score 1637.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

AA Sequence

MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQK      1 - 70
RPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTI     71 - 140
SSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD                                       141 - 175
//

Text Mined References (48)

PMID Year Title