Property Summary

NCBI Gene PubMed Count 43
Grant Count 26
R01 Count 8
Funding $1,396,836.17
PubMed Score 379.96
PubTator Score 1637.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (29)

PMID Text
26719042 Regulation network analysis confirmed the cell growth related differentially expressed genes, and further uncovered three transcription factor families with immune functions regulated by REG3A
26646797 Up-regulation of REG3A correlates with colorectal cancer risk.
26404002 our findings reveal a dual and contextual pathophysiologic role for REG3beta during pancreatitis and pancreatic ductal adenocarcinoma initiation
25938566 Reg3alpha is an extracellular matrix-targeted reactive oxygen species scavenger that binds the fibrin scaffold resulting from hepatocyte death during acute liver failure.
25751817 Reg3beta-dependent accumulation of macrophages in the ischemic heart has a role in myocardial healing
25112824 Serum regenerating islet-derived 3-alpha is a biomarker of mucosal enteropathies
24996521 Reg3A overexpression promoted cell growth in pancreatic cancer. SOCS3 is a key target in cancer by inhibiting cell growth and inducing apoptosis. SOCS3 negatively regulated Reg3A-mediated cell growth in pancreatic cancer.
24256734 human RegIIIalpha (also known as HIP/PAP) binds membrane phospholipids and kills bacteria by forming a hexameric membrane-permeabilizing oligomeric pore
24096422 Both live and heat-inactivated Bifidobacterium breve induced the expression of REGIII-alpha, the human ortholog and homolog of REGIII-gamma, in human colonic epithelial cells (Caco-2).
23743605 Cells transfected with REG III exhibited significantly lower cell proliferation.
More...

AA Sequence

MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQK      1 - 70
RPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTI     71 - 140
SSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD                                       141 - 175
//

Text Mined References (43)

PMID Year Title
26719042 2016 Microarray-based gene expression profiling reveals genes and pathways involved in the oncogenic function of REG3A on pancreatic cancer cells.
26646797 2016 Up-regulation of REG3A in colorectal cancer cells confers proliferation and correlates with colorectal cancer risk.
26404002 2015 IL17 Functions through the Novel REG3?-JAK2-STAT3 Inflammatory Pathway to Promote the Transition from Chronic Pancreatitis to Pancreatic Cancer.
25938566 2015 The Reg3? (HIP/PAP) Lectin Suppresses Extracellular Oxidative Stress in a Murine Model of Acute Liver Failure.
25751817 2015 Myocardial healing requires Reg3?-dependent accumulation of macrophages in the ischemic heart.
25416956 2014 A proteome-scale map of the human interactome network.
25112824 2014 Serum regenerating islet-derived 3-alpha is a biomarker of mucosal enteropathies.
24996521 2014 SOCS3 methylation in synergy with Reg3A overexpression promotes cell growth in pancreatic cancer.
24256734 2014 Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
24096422 2013 Differential induction of antimicrobial REGIII by the intestinal microbiota and Bifidobacterium breve NCC2950.
More...