Property Summary

NCBI Gene PubMed Count 17
PubMed Score 15.31
PubTator Score 9.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.141 1.7e-02
Astrocytoma, Pilocytic 1.300 3.3e-04
Breast cancer -1.200 3.3e-07
Down syndrome 1.100 3.3e-03
gastric cancer 1.100 3.7e-02
invasive ductal carcinoma -1.100 3.5e-03
Multiple myeloma 1.568 6.4e-03
ovarian cancer -1.200 1.4e-04
pancreatic ductal adenocarcinoma liver m... -1.957 7.4e-04
tuberculosis and treatment for 6 months -1.300 2.6e-02

Gene RIF (8)

AA Sequence

MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLL      1 - 70
QAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFER     71 - 140
LMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVY    141 - 210
ITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCG    211 - 280
MAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTA                      281 - 332
//

Text Mined References (18)

PMID Year Title