Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.31
PubTator Score 1.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.392 0.003
Multiple myeloma 1.537 0.000
osteosarcoma 1.165 0.006
lung cancer 1.700 0.000
ovarian cancer 2.300 0.000

Synonym

Accession Q06055 B3KQQ6
Symbols ATP5A

Gene

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDT      1 - 70
AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA     71 - 140
M//

Text Mined References (18)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
16541075 2006 The finished DNA sequence of human chromosome 12.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749816 2004 Molecular motors: turning the ATP motor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
More...