Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.06
PubTator Score 1.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.700 2.0e-04
Multiple myeloma 1.537 4.7e-04
osteosarcoma 1.165 5.5e-03
ovarian cancer 1.100 8.1e-09
Waldenstrons macroglobulinemia 1.392 2.9e-03

Gene RIF (2)

AA Sequence

MFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDT      1 - 70
AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA     71 - 140
M//

Text Mined References (18)

PMID Year Title