Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.90
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2843 5.2e-42
posterior fossa group B ependymoma 416 2.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Asthma 385 0.0 1.1
Disease Target Count Z-score Confidence
Papillary thyroid carcinoma 43 3.205 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 5.200 5.2e-42
posterior fossa group B ependymoma 1.200 2.7e-05

Gene RIF (3)

AA Sequence

MENQAHNTMGTSPCEAELQELMEQIDIMVSNKKMDWERKMRALETRLDLRDQELANAQTCLDQKGQEVGL      1 - 70
LRQKLDSLEKCNLAMTQNYEGQLQSLKAQFSKLTNNFEKLRLHQMKQNKVPRKELPHLKEEIPFELSNLN     71 - 140
QKLEEFRAKSREWDKQEILYQTHLISLDAQQKLLSEKCNQFQKQAQSYQTQLNGKKQCLEDSSSEIPRLI    141 - 210
CDPDPNCEINERDEFIIEKLKSAVNEIALSRNKLQDENQKLLQELKMYQRQCQAMEAGLSEVKSELQSRD    211 - 280
DLLRIIEMERLQLHRELLKIGECQNAQGNKTRLESSYLPSIKEPERKIKELFSVMQDQPNHEKELNKIRS    281 - 350
QLQQVEEYHNSEQERMRNEISDLTEELHQKEITIATVTKKAALLEKQLKMELEIKEKMLAKQKVSDMKYK    351 - 420
AVRTENTHLKGMMGDLDPGEYMSMDFTNREQSRHTSINKLQYENERLRNDLAKLHVNGKSTWTNQNTYEE    421 - 490
TGRYAYQSQIKVEQNEERLSHDCEPNRSTMPPLPPSTFQAKEMTSPLVSDDDVFPLSPPDMSFPASLAAQ    491 - 560
HFLLEEEKRAKELEKLLNTHIDELQRHTEFTLNKYSKLKQNRHI                              561 - 604
//

Text Mined References (13)

PMID Year Title