Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.63
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q05D32 Q3ZTU1 Q6AI06 Q8IYI9 Q9NVT2 Q9NZX8 Q9P030 CTDSP-like 2
Symbols HSPC058
HSPC129

Gene

Gene RIF (1)

PMID Text
20932329 increases epsilon- and gamma-globin gene expression during erythroid differentiation

AA Sequence

MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSK      1 - 70
RSRIERDIDNNLITSTPRAGEKPNKQISRVRRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTL     71 - 140
LGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPS    141 - 210
LNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPL    211 - 280
KTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTA    281 - 350
SKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPI    351 - 420
ESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD                            421 - 466
//

Publication (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20932329 2010 CTD small phosphatase like 2 (CTDSPL2) can increase ?- and ?-globin gene expression in K562 cells and CD34+ cells derived from umbilical cord blood.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...