Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.63
PubTator Score 3.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.30057759635293E-8
medulloblastoma, large-cell 6234 3.79138967112093E-7
group 4 medulloblastoma 1875 4.2538957630094E-6
pituitary cancer 1972 2.01850935705715E-5
Pick disease 1893 4.55276792607342E-5
ovarian cancer 8492 4.78642351116389E-5
atypical teratoid / rhabdoid tumor 4369 5.97029811454549E-5
primitive neuroectodermal tumor 3031 2.91237485939385E-4
osteosarcoma 7933 3.26266407338093E-4
ependymoma 2514 4.7334852958115E-4
tuberculosis and treatment for 6 months 686 0.00348123063108164
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00541307959990207
primary pancreatic ductal adenocarcinoma 1271 0.00875956299589888
glioblastoma 5572 0.0282265709256661
pediatric high grade glioma 2712 0.0288320249668019
Disease Target Count Z-score Confidence
Beta thalassemia 19 3.319 1.7

Expression

Synonym

Accession Q05D32 Q3ZTU1 Q6AI06 Q8IYI9 Q9NVT2 Q9NZX8 Q9P030 CTDSP-like 2
Symbols HSPC058
HSPC129

Gene

  Ortholog (11)

Pathway (1)

Gene RIF (1)

PMID Text
20932329 increases epsilon- and gamma-globin gene expression during erythroid differentiation

AA Sequence

MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSK      1 - 70
RSRIERDIDNNLITSTPRAGEKPNKQISRVRRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTL     71 - 140
LGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPS    141 - 210
LNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPL    211 - 280
KTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTA    281 - 350
SKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPI    351 - 420
ESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD                            421 - 466
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20932329 2010 CTD small phosphatase like 2 (CTDSPL2) can increase ?- and ?-globin gene expression in K562 cells and CD34+ cells derived from umbilical cord blood.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...