Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.70
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.000 6.0e-05
ependymoma 1.300 4.7e-04
glioblastoma 1.300 2.8e-02
group 3 medulloblastoma 1.600 7.1e-04
intraductal papillary-mucinous neoplasm ... 1.300 5.4e-03
medulloblastoma, large-cell 2.500 3.8e-07
non-small cell lung cancer 1.046 3.3e-08
osteosarcoma 2.949 3.3e-04
ovarian cancer -1.200 4.8e-05
pediatric high grade glioma 1.100 2.9e-02
Pick disease -1.200 4.6e-05
pituitary cancer 1.300 2.0e-05
primary pancreatic ductal adenocarcinoma 1.035 8.8e-03
primitive neuroectodermal tumor 1.300 2.9e-04
tuberculosis and treatment for 6 months 1.100 3.5e-03

Gene RIF (3)

AA Sequence

MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSK      1 - 70
RSRIERDIDNNLITSTPRAGEKPNKQISRVRRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTL     71 - 140
LGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPS    141 - 210
LNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPL    211 - 280
KTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTA    281 - 350
SKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPI    351 - 420
ESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD                            421 - 466
//

Text Mined References (20)

PMID Year Title