Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 2.4e-02
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.0
Disease Target Count Z-score Confidence
Polycythemia 25 3.365 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.300 2.4e-02

AA Sequence

MQKPPLLLRRPLPPKFTKLSLHEKKTHTAKTGKIESLHVAFTEDETTSIKMDRTRFPDVLRNQSLTPINI      1 - 70
QNIFLDHCVQERVTAISSPQKSTKHVREQIPDTATGSIFFPHCNSASTRIFGKQTNKMESSRKFKTMKDV     71 - 140
YTEKRLENILILSSKFSKPKSTPGSVIAQKLEKMHPKHQPLPESPGYTYQHISRDLSATVPSPPPMTVSM    141 - 210
KPEGQWPEHFKSTATLTLRVTEFPGFVSLPTPVLPRKPHRQSVIETLVTENGNIESVPKQIPPRPPEGLT    211 - 280
KTEKIESEIHVVRGEGFKTVAATRYETITAMTNLAIVNCQVYGRNALNLKGFFILNCPDLTPLAFQLIYL    281 - 350
NLSFNDLHYFPTEILCLKNLQILKLRNNPIKEIPSEIQQLEFLRIFTIAFNLITVLPIGLFSLSYLEELD    351 - 420
VSYNELTFIPNEIQKLRSLEKLTVDGNELSFFPHGILKLNLTKIQFENNFTHPCFWRDNYLNNPQQLTQI    421 - 490
ISLFIVQNKLHKFYDKIPVEVQKLLKWGAQFLTELAPLSIYSSRKAITEGYIAVELPKFEESKNITEGLL    491 - 560
TQKRYEEVMVKCINATTVTS                                                      561 - 580
//

Text Mined References (4)

PMID Year Title