Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.300 0.024

Synonym

Accession Q05C16 Q5TBN0
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MQKPPLLLRRPLPPKFTKLSLHEKKTHTAKTGKIESLHVAFTEDETTSIKMDRTRFPDVLRNQSLTPINI      1 - 70
QNIFLDHCVQERVTAISSPQKSTKHVREQIPDTATGSIFFPHCNSASTRIFGKQTNKMESSRKFKTMKDV     71 - 140
YTEKRLENILILSSKFSKPKSTPGSVIAQKLEKMHPKHQPLPESPGYTYQHISRDLSATVPSPPPMTVSM    141 - 210
KPEGQWPEHFKSTATLTLRVTEFPGFVSLPTPVLPRKPHRQSVIETLVTENGNIESVPKQIPPRPPEGLT    211 - 280
KTEKIESEIHVVRGEGFKTVAATRYETITAMTNLAIVNCQVYGRNALNLKGFFILNCPDLTPLAFQLIYL    281 - 350
NLSFNDLHYFPTEILCLKNLQILKLRNNPIKEIPSEIQQLEFLRIFTIAFNLITVLPIGLFSLSYLEELD    351 - 420
VSYNELTFIPNEIQKLRSLEKLTVDGNELSFFPHGILKLNLTKIQFENNFTHPCFWRDNYLNNPQQLTQI    421 - 490
ISLFIVQNKLHKFYDKIPVEVQKLLKWGAQFLTELAPLSIYSSRKAITEGYIAVELPKFEESKNITEGLL    491 - 560
TQKRYEEVMVKCINATTVTS                                                      561 - 580
//

Text Mined References (4)

PMID Year Title
17903304 2007 Framingham Heart Study 100K project: genome-wide associations for cardiovascular disease outcomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.