Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q05BU3 Q8IW37
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPGAFSQNSSKRRAVLPRSHRVAGRGPAEAGCLPGAPAGS                                    1 - 40
//

Text Mined References (5)

PMID Year Title