Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.06
PubTator Score 3.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.200 3.8e-02
atypical teratoid/rhabdoid tumor 1.100 5.8e-03
ependymoma 1.300 3.1e-02
glioblastoma 1.100 6.5e-05
group 3 medulloblastoma 2.200 2.5e-03
malignant mesothelioma 1.300 3.9e-05
medulloblastoma, large-cell 1.700 7.0e-04
oligodendroglioma 1.600 1.6e-02
osteosarcoma 1.250 1.3e-03
primitive neuroectodermal tumor 1.400 3.8e-04
progressive supranuclear palsy -1.100 2.9e-02

Gene RIF (3)

AA Sequence

MFDGYDSCSEDTSSSSSSEESEEEVAPLPSNLPIIKNNGQVYTYPDGKSGMATCEMCGMVGVRDAFYSKT      1 - 70
KRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLQKQPLVAKLAAYAQYQATLQNQAKTKAAVSMEG     71 - 140
FSWGNYINSNSFIAAPVTCFKHAPMGTCWGDISENVRVEVPNTDCSLPTKVFWIAGIVKLAGYNALLRYE    141 - 210
GFENDSGLDFWCNICGSDIHPVGWCAASGKPLVPPRTIQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSES    211 - 280
MQYPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHR    281 - 350
FKRSDITKKQDGHFDTPPHLFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGID    351 - 420
GSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKDVPNH    421 - 490
GFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGWCQLTGYQLQPP    491 - 560
ASQSSRENQSASSKQKKKAKSQQYKGHKKMTTLQLKEELLDGEDYNFLQGASDQESNGSANFYIKQEP      561 - 628
//

Text Mined References (9)

PMID Year Title