Property Summary

NCBI Gene PubMed Count 24
Grant Count 15
R01 Count 15
Funding $1,430,573.01
PubMed Score 56.71
PubTator Score 121.96

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (12)

PMID Text
25536093 the quantity of PRM1, PRM2, and TNP2 transcripts and the PRM1/PRM2 mRNA ratio affect spermiogenesis, sperm morphology
23327642 MiR-122 may influence spermatozoa-like cells by suppressing TNP2 expression and inhibiting the expression of proteins associated with sperm development.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20522125 analysis of the TNP2 gene did not show any association with infertility.
20522125 Observational study of gene-disease association. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
19710011 Acetylation of transition protein 2 (TP2) by KAT3B (p300) alters its DNA condensation property and interaction with putative histone chaperone NPM3.
19460752 Knockdown of transition protein 2 (during histone to protamine replacement) (TNP2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18727729 The presence of transition proteins (TP1 and/or TP2) in spermatids in semen indicates inhibition in the differentiation pathway from round spermatids to spermatozoa in infertile men.
17852044 We found significantly lower levels of HILS1, TNP1, and TNP2 transcripts in spermatozoa from asthenozoospermic men compared to normozoospermic men.
More...

AA Sequence

MDTQTHSLPITHTQLHSNSQPQSRTCTRHCQTFSQSCRQSHRGSRSQSSSQSPASHRNPTGAHSSSGHQS      1 - 70
QSPNTSPPPKRHKKTMNSHHSPMRPTILHCRCPKNRKNLEGKLKKKKMAKRIQQVYKTKTRSSGWKSN       71 - 138
//

Text Mined References (24)

PMID Year Title
25536093 2015 Quantification of sperm specific mRNA transcripts (PRM1, PRM2, and TNP2) in teratozoospermia and normozoospermia: New correlations between mRNA content and morphology of sperm.
23568457 2013 Genetic variants associated with disordered eating.
23327642 2013 MicroRNA-122 influences the development of sperm abnormalities from human induced pluripotent stem cells by regulating TNP2 expression.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20522125 2011 The TNP1 haplotype - GCG is associated with azoospermia.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19710011 2009 Acetylation of transition protein 2 (TP2) by KAT3B (p300) alters its DNA condensation property and interaction with putative histone chaperone NPM3.
18978792 2008 Meta-analysis of genome-wide association study data identifies additional type 1 diabetes risk loci.
18727729 2008 Spermiogenesis defects in human: detection of transition proteins in semen from some infertile men.
More...