Property Summary

NCBI Gene PubMed Count 24
PubMed Score 56.57
PubTator Score 121.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (12)

AA Sequence

MDTQTHSLPITHTQLHSNSQPQSRTCTRHCQTFSQSCRQSHRGSRSQSSSQSPASHRNPTGAHSSSGHQS      1 - 70
QSPNTSPPPKRHKKTMNSHHSPMRPTILHCRCPKNRKNLEGKLKKKKMAKRIQQVYKTKTRSSGWKSN       71 - 138
//

Text Mined References (24)

PMID Year Title