Property Summary

NCBI Gene PubMed Count 78
Grant Count 613
R01 Count 285
Funding $96,453,183.07
PubMed Score 911.75
PubTator Score 325.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.500 0.000
cutaneous lupus erythematosus -1.400 0.001
osteosarcoma -4.361 0.000
medulloblastoma, large-cell 1.400 0.000
Atopic dermatitis -1.600 0.000
non-small cell lung cancer -1.450 0.000
invasive ductal carcinoma 1.403 0.002
head and neck cancer -1.500 0.009

Synonym

Accession Q05940 B2RC96 D3DRC4 Q15876 Q4G147 Q5VW49 Q9H3P6
Symbols SVAT
SVMT
VAT2
VMAT2

Gene

Gene RIF (65)

PMID Text
26497564 describe a second case of infantile-onset movement disorder caused by a different mutation in SLC18A2 compared to PMID:23363473, and partial improvement of symptoms upon treatment with pramipexole; supports identification of causal mutation in index case.
26338179 VMAT1 and VMAT2 are expressed in the majority of neuroblastomas
24018103 The finding of this study provide support for a role of VMAT2 in tardive dyskinesia and add to evidence that VMAT2 may be a potential therapeutic target in the treatment of TD.
23932573 Two SNPs (rs10082463 & rs363285) of SLC18A2 were nominally associated with cognition.
23573890 Chromogranin A and vesicular monoamine transporter 2 are localized in protein bodies of human locus coeruleus neurons.
23530208 homology model of VMAT2 shows that molecular hinge points mediate alternating access
23504951 VMAT2 expression dynamically decreased in the neocortex of temporal lobe epilepsy patients when compared with the control subjects.
23504072 VMAT2 genetic variants contribute to the phenotypes of alcohol dependence.
23410751 These results may indicate that VMAT2 expressed in noradrenergic neurons has crucial roles in survival during the first several weeks after birth, and VMAT2 functions in other monoaminergic systems could be required for further extended survival.
23404442 Data suggest that pancreatic islets of humans and pigs contain VMAT2 in similar patterns (in beta cells, mast cells, and sympathetic neurons); therefore, the pig (unlike rodents) is potential model for imaging pancreas using radioligands for VMAT2.
More...

AA Sequence

MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTAS      1 - 70
ISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT     71 - 140
VQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASV    141 - 210
YTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQ    211 - 280
KGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGI    281 - 350
LAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS    351 - 420
VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPI    421 - 490
KTKMYTQNNIQSYPIGEDEESESD                                                  491 - 514
//

Text Mined References (81)

PMID Year Title
26497564 2016 Brain dopamine-serotonin vesicular transport disease presenting as a severe infantile hypotonic parkinsonian disorder.
26338179 2016 Vesicular monoamine transporter protein expression correlates with clinical features, tumor biology, and MIBG avidity in neuroblastoma: a report from the Children's Oncology Group.
24252804 2013 The role of oxidative stress in Parkinson's disease.
24018103 2013 Association study of the vesicular monoamine transporter gene SLC18A2 with tardive dyskinesia.
23932573 2013 Dopaminergic gene polymorphisms and cognitive function in a north Indian schizophrenia cohort.
23573890 2013 Chromogranin A and vesicular monoamine transporter 2 immunolocalization in protein bodies of human locus coeruleus neurons.
23530208 2013 Identification of molecular hinge points mediating alternating access in the vesicular monoamine transporter VMAT2.
23504951 2013 Altered expression of vesicular monoamine transporter 2 in epileptic patients and experimental rats.
23504072 2013 Association of VMAT2 gene polymorphisms with alcohol dependence.
23410751 2013 Exclusive expression of VMAT2 in noradrenergic neurons increases viability of homozygous VMAT2 knockout mice.
More...