Property Summary

Ligand Count 12
NCBI Gene PubMed Count 81
PubMed Score 970.07
PubTator Score 325.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -1.600 6.7e-05
cutaneous lupus erythematosus -1.400 1.3e-03
head and neck cancer -1.500 9.4e-03
invasive ductal carcinoma 1.115 6.2e-03
medulloblastoma, large-cell 1.400 1.1e-04
non-small cell lung cancer -1.450 3.3e-19
osteosarcoma -1.353 7.3e-05
psoriasis -1.400 9.1e-08

Protein-protein Interaction (2)

Gene RIF (68)

AA Sequence

MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTAS      1 - 70
ISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT     71 - 140
VQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASV    141 - 210
YTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQ    211 - 280
KGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGI    281 - 350
LAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS    351 - 420
VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPI    421 - 490
KTKMYTQNNIQSYPIGEDEESESD                                                  491 - 514
//

Text Mined References (84)

PMID Year Title