Property Summary

Ligand Count 14
NCBI Gene PubMed Count 60
PubMed Score 79.84
PubTator Score 197.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 3.7e-09
glioblastoma 1.200 1.9e-05
medulloblastoma, large-cell 1.300 4.9e-05

 IMPC Phenotype (1)

Gene RIF (45)

AA Sequence

MSRARSHLRAALFLAAASARGITTQVAARRGLSAWPVPQEPSMEYQDAVRMLNTLQTNAGYLEQVKRQRG      1 - 70
DPQTQLEAMELYLARSGLQVEDLDRLNIIHVTGTKGKGSTCAFTECILRSYGLKTGFFSSPHLVQVRERI     71 - 140
RINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCT    141 - 210
NIIRKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLC    211 - 280
PMLEALEEGGPPLTLGLEGEHQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSH    281 - 350
MRLGLRNTEWPGRTQVLRRGPLTWYLDGAHTASSAQACVRWFRQALQGRERPSGGPEVRVLLFNATGDRD    351 - 420
PAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSAP    421 - 490
SPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSPPKGLLTHPVAHSGASILREA    491 - 560
AAIHVLVTGSLHLVGGVLKLLEPALSQ                                               561 - 587
//

Text Mined References (68)

PMID Year Title