Property Summary

NCBI Gene PubMed Count 56
Grant Count 39
R01 Count 29
Funding $7,222,152.67
PubMed Score 80.94
PubTator Score 197.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.300 0.000

 IMPC Term (1)

Gene RIF (41)

PMID Text
26895662 data suggest that FPGS modulation affects global and promoter CpG DNA methylation and expression of several genes involved in important biological pathways
26751406 529 adults (n = 325 European-Americans, 204 Egyptians) on a stable warfarin dose were genotyped for GGCX rs12714145 and rs10654848, FPGS rs7856096, and STX1B rs4889606.
26676887 the highest expression of GGH and EGFR was noted in the left-sided colon; the highest expression of DHFR, FPGS, TOP1 and ERCC1 was noted in the rectosigmoid, whereas TYMP expression was approximately equivalent in the right-sided colon and rectum
26652611 FPGS and ABCB1 genetic variants can influence the outcome in RA patients receiving MTX monotherapy.
26107232 Genetic polymorphisms in the FPGS coding region are significantly associated with increased Acute Lymphoblastic Leukemia risk.
25765001 study found that genetic polymorphism of FPGS rs10760502A > G is associated with susceptibility to primary retroperitoneal liposasrcoma
25229333 antifolate resistant leukemia cells harbor a heterozygous point mutation in exon12 of FPGS which disrupts FPGS activity by abolishing ATP binding, and alters the binding pattern of transcription factors to the genomic region of exon12.
25164808 mitochondrial FPGS is required because folate polyglutamates are not substrates for transport across the mitochondrial membrane
24908438 Polymorphism of FPGS rs1544105 G>A is associated with response to therapy in acute lymphoblastic leukemia.
24583629 Genome-wide association studies identify 10 novel genetic loci as risk factors for methotrexate response in rheumatoid arthritis patients additionally to polymorphism in DHFR, FPGS and TYMS.
More...

AA Sequence

MSRARSHLRAALFLAAASARGITTQVAARRGLSAWPVPQEPSMEYQDAVRMLNTLQTNAGYLEQVKRQRG      1 - 70
DPQTQLEAMELYLARSGLQVEDLDRLNIIHVTGTKGKGSTCAFTECILRSYGLKTGFFSSPHLVQVRERI     71 - 140
RINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCT    141 - 210
NIIRKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLC    211 - 280
PMLEALEEGGPPLTLGLEGEHQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSH    281 - 350
MRLGLRNTEWPGRTQVLRRGPLTWYLDGAHTASSAQACVRWFRQALQGRERPSGGPEVRVLLFNATGDRD    351 - 420
PAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSAP    421 - 490
SPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSPPKGLLTHPVAHSGASILREA    491 - 560
AAIHVLVTGSLHLVGGVLKLLEPALSQ                                               561 - 587
//

Text Mined References (64)

PMID Year Title
26895662 2016 Effects of folylpolyglutamate synthase modulation on global and gene-specific DNA methylation and gene expression in human colon and breast cancer cells.
26751406 2016 Impact of GGCX, STX1B and FPGS Polymorphisms on Warfarin Dose Requirements in European-Americans and Egyptians.
26676887 2016 Association between mRNA expression of chemotherapy-related genes and clinicopathological features in colorectal cancer: A large-scale population analysis.
26652611 2016 Methotrexate pharmacokinetic genetic variants are associated with outcome in rheumatoid arthritis patients.
26107232 2015 Mutation Screening and Association Study of the Folylpolyglutamate Synthetase (FPGS) Gene with Susceptibility to Childhood Acute Lymphoblastic Leukemia.
25765001 2015 Association of FPGS genetic polymorphisms with primary retroperitoneal liposarcoma.
25229333 2014 Binding of a Smad4/Ets-1 complex to a novel intragenic regulatory element in exon12 of FPGS underlies decreased gene expression and antifolate resistance in leukemia.
25164808 2014 Mammalian mitochondrial and cytosolic folylpolyglutamate synthetase maintain the subcellular compartmentalization of folates.
24908438 2014 Influence of genetic polymorphisms of FPGS, GGH, and MTHFR on serum methotrexate levels in Chinese children with acute lymphoblastic leukemia.
24583629 2014 Genome-wide analysis of methotrexate pharmacogenomics in rheumatoid arthritis shows multiple novel risk variants and leads for TYMS regulation.
More...