Property Summary

NCBI Gene PubMed Count 32
PubMed Score 264.63
PubTator Score 58.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.900 1.7e-02
Breast cancer 1.600 1.5e-03
glioblastoma 1.900 1.2e-03
medulloblastoma, large-cell 1.200 1.9e-02
primitive neuroectodermal tumor 1.400 4.5e-02
psoriasis -1.800 8.4e-09
subependymal giant cell astrocytoma 2.465 1.3e-02

 GO Component (1)

Gene RIF (20)

AA Sequence

MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAH      1 - 70
HPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGG     71 - 140
RVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVA    141 - 210
AAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTR    211 - 280
YSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIW    281 - 350
FQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE                                351 - 392
//

Text Mined References (33)

PMID Year Title