Property Summary

NCBI Gene PubMed Count 31
Grant Count 57
R01 Count 43
Funding $6,291,085.94
PubMed Score 257.47
PubTator Score 58.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.800 0.000
glioblastoma 2.700 0.002
medulloblastoma, large-cell 1.200 0.019
primitive neuroectodermal tumor 1.400 0.045
adult high grade glioma 1.900 0.017
subependymal giant cell astrocytoma 2.465 0.013
Breast cancer 1.600 0.002

Synonym

Accession Q05925 Q4ZG44 Homeobox protein en-1
Symbols

Gene

EN1

 GO Component (1)

Gene RIF (19)

PMID Text
26367794 low-frequency non-coding variant near a novel locus, EN1, with an effect on bone mineral density--which was also associated with a decreased risk of fracture
24685177 The current review describes the role of two such factors, Nurr1 and engrailed, in differentiation, maturation, and in normal physiological functions including acquisition of neurotransmitter identity.
24141779 EN1 is an activator of intrinsic inflammatory pathways associated with prosurvival in basal-like breast cancer.
21800291 EN1 is a biologic predictor of poor prognosis in patients with salivary adenoid cystic carcinoma.
21672318 Homeobox protein engrailed-1 protein regulates transcription of the utrophin gene.
21482524 EN1 might be a negative regulatory factor for UTROPHIN.
20944657 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAH      1 - 70
HPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGG     71 - 140
RVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVA    141 - 210
AAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTR    211 - 280
YSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIW    281 - 350
FQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE                                351 - 392
//

Text Mined References (32)

PMID Year Title
26367794 2015 Whole-genome sequencing identifies EN1 as a determinant of bone density and fracture.
24685177 2014 The lifelong maintenance of mesencephalic dopaminergic neurons by Nurr1 and engrailed.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24399192 2014 Differentiation of human epidermal neural crest stem cells (hEPI-NCSC) into virtually homogenous populations of dopaminergic neurons.
24141779 2014 Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function.
21800291 2012 Developmental transcription factor EN1--a novel biomarker in human salivary gland adenoid cystic carcinoma.
21672318 2011 A method of utrophin up-regulation through RNAi-mediated knockdown of the transcription factor EN1.
21482524 2011 [The regulation of UTROPHIN expression by EN1].
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...