Tbio | Homeobox protein engrailed-1 |
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Adenoid Cystic Carcinoma | 99 |
Neoplasm Invasiveness | 127 |
Salivary Gland Neoplasms | 45 |
nervous system disorder | 53 |
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 8.41154268795812E-9 |
Breast cancer | 3099 | 0.00154482195785273 |
glioblastoma | 5572 | 0.00212713325329082 |
subependymal giant cell astrocytoma | 2287 | 0.0131632507149085 |
adult high grade glioma | 2148 | 0.0168691595151544 |
medulloblastoma, large-cell | 6234 | 0.018777026050396 |
primitive neuroectodermal tumor | 3031 | 0.0450372443013967 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Parkinson's disease | 364 | 3.928 | 2.0 |
Lesch-Nyhan syndrome | 12 | 3.127 | 1.6 |
Syndactyly | 56 | 3.118 | 1.6 |
Disease | log2 FC | p |
---|---|---|
psoriasis | -1.800 | 0.000 |
glioblastoma | 2.700 | 0.002 |
medulloblastoma, large-cell | 1.200 | 0.019 |
primitive neuroectodermal tumor | 1.400 | 0.045 |
adult high grade glioma | 1.900 | 0.017 |
subependymal giant cell astrocytoma | 2.465 | 0.013 |
Breast cancer | 1.600 | 0.002 |
Accession | Q05925 Q4ZG44 Homeobox protein en-1 |
Symbols |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA Inparanoid |
Cow | OMA EggNOG |
Pig | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26367794 | low-frequency non-coding variant near a novel locus, EN1, with an effect on bone mineral density--which was also associated with a decreased risk of fracture |
24685177 | The current review describes the role of two such factors, Nurr1 and engrailed, in differentiation, maturation, and in normal physiological functions including acquisition of neurotransmitter identity. |
24141779 | EN1 is an activator of intrinsic inflammatory pathways associated with prosurvival in basal-like breast cancer. |
21800291 | EN1 is a biologic predictor of poor prognosis in patients with salivary adenoid cystic carcinoma. |
21672318 | Homeobox protein engrailed-1 protein regulates transcription of the utrophin gene. |
21482524 | EN1 might be a negative regulatory factor for UTROPHIN. |
20944657 | Observational study of gene-disease association. (HuGE Navigator) |
20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) |
19913121 | Observational study of gene-disease association. (HuGE Navigator) |
19453261 | Observational study of gene-disease association. (HuGE Navigator) |
More... |
MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAH 1 - 70 HPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGG 71 - 140 RVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVA 141 - 210 AAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTR 211 - 280 YSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIW 281 - 350 FQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE 351 - 392 //
PMID | Year | Title |
---|---|---|
26367794 | 2015 | Whole-genome sequencing identifies EN1 as a determinant of bone density and fracture. |
24685177 | 2014 | The lifelong maintenance of mesencephalic dopaminergic neurons by Nurr1 and engrailed. |
24431302 | 2014 | Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease. |
24399192 | 2014 | Differentiation of human epidermal neural crest stem cells (hEPI-NCSC) into virtually homogenous populations of dopaminergic neurons. |
24141779 | 2014 | Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. |
21800291 | 2012 | Developmental transcription factor EN1--a novel biomarker in human salivary gland adenoid cystic carcinoma. |
21672318 | 2011 | A method of utrophin up-regulation through RNAi-mediated knockdown of the transcription factor EN1. |
21482524 | 2011 | [The regulation of UTROPHIN expression by EN1]. |
20944657 | 2011 | Replication of top markers of a genome-wide association study in multiple sclerosis in Spain. |
20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. |
More... |