Property Summary

Ligand Count 1
NCBI Gene PubMed Count 58
PubMed Score 20.23
PubTator Score 23.40

Knowledge Summary

Patent (1,106)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (47)

AA Sequence

MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDE      1 - 70
KNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGT     71 - 140
VVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMK    141 - 210
GNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLL    211 - 280
VIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMK    281 - 350
DHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK    351 - 420
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH                                    421 - 458
//

Text Mined References (58)

PMID Year Title