Property Summary

NCBI Gene PubMed Count 54
Grant Count 9
R01 Count 9
Funding $658,586.99
PubMed Score 18.49
PubTator Score 23.40

Knowledge Summary

Patent (1,106)

 GWAS Trait (1)

Gene RIF (44)

PMID Text
26318101 Data provide evidence that the protective genetic variant at rs6474413 identified in human genetic studies reduces gene expression and that decreased beta3 gene expression in mice reduces nicotine intake
25823894 Polymorphism in CHRNB3 gene is associated with esophageal adenocarcinoma.
25068303 Data show efficient expression of (alpha6beta2)2beta3 nicotinic acetylcholine receptors (AChRs) in Xenopus oocytes using free subunits with only small changes in alpha6 subunits, while not altering AChR pharmacology or channel structure.
24792900 these results demonstrate that the combined effect of rs6474412-C/T polymorphism in smoking-related CHRNB3-CHRNA6 region gene and smoking behavior may not confer risk to psoriasis vulgaris (PV), but may have impact on PV severity in Chinese Han population.
24731518 CHRNB3 c.-57A>G alteration affects the promoter activity and is associated with Parkinson's disease (PD), and smoking in PD patients.
24675634 the CHRNB3-A6 locus contains multiple variants affecting risk for vulnerability to cocaine and nicotine dependence as well as bipolar disorder, suggesting that they have pleiotropic effects.
24401102 The common variant rs13273442 in the CHRNB3-CHNRA6 region is associated significantly with nicotine dependence in European Americans and African Americans.
24057674 Rare missense variants in CHRNB3 and CHRNA3 are associated with risk of alcohol and cocaine dependence.
24001015 This patient's chromosomal abnormality affected only one gene that is highly expressed in the brainstem and brain, involved in neurotransmission, and could be related to her Duane retraction syndrome.
23943838 Level of cigarettes per day during adolescence and young adulthood is associated with CHRNB3A6, CHRNA5A3B4, and CHRNA2
More...

AA Sequence

MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDE      1 - 70
KNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGT     71 - 140
VVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMK    141 - 210
GNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLL    211 - 280
VIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMK    281 - 350
DHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK    351 - 420
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH                                    421 - 458
//

Text Mined References (54)

PMID Year Title
26318101 2015 The ?3 subunit of the nicotinic acetylcholine receptor: Modulation of gene expression and nicotine consumption.
25823894 2015 A genetic variant in CHRNB3-CHRNA6 increases risk of esophageal squamous cell carcinoma in Chinese populations.
25068303 2014 Efficient expression of functional (?6?2)2?3 AChRs in Xenopus oocytes from free subunits using slightly modified ?6 subunits.
24792900 2014 Combined effect between CHRNB3-CHRNA6 region gene variant (rs6474412) and smoking in psoriasis vulgaris severity.
24731518 2014 CHRNB3 c.-57A>G functional promoter change affects Parkinson's disease and smoking.
24675634 2014 Variants near CHRNB3-CHRNA6 are associated with DSM-5 cocaine use disorder: evidence for pleiotropy.
24401102 2014 Multiple distinct CHRNB3-CHRNA6 variants are genetic risk factors for nicotine dependence in African Americans and European Americans.
24057674 2014 Rare missense variants in CHRNB3 and CHRNA3 are associated with risk of alcohol and cocaine dependence.
24001015 2015 Nicotinic Receptor Mutation in a Mildly Dysmorphic Girl with Duane Retraction Syndrome.
23943838 2014 Effect of neuronal nicotinic acetylcholine receptor genes (CHRN) on longitudinal cigarettes per day in adolescents and young adults.
More...