Property Summary

NCBI Gene PubMed Count 126
Grant Count 201
R01 Count 109
Funding $22,734,545.11
PubMed Score 493.78
PubTator Score 397.12

Knowledge Summary

Patent (24,366)

Expression

Synonym

Accession Q05823 Q5W0L2 Q6AI46 2-5A-dependent RNase
Symbols RNS4
PRCA1

Gene

PDB

1WDY   4G8K   4G8L   4OAU   4OAV  

 GWAS Trait (1)

Gene RIF (124)

PMID Text
26858407 OAS3 displayed a higher affinity for dsRNA in intact cells than either OAS1 or OAS2, consistent with its dominant role in RNase L activation.
26771888 Single Nucleotide Polymorphisms in RNASEL involved in the immune response are generally not associated with intraprostatic inflammation in men without a Prostate cancer diagnosis.
26760998 This review outlines the role of RNase-L in antimicrobial immunity and the cytoskeleton-associated innate response. [review]
26668391 Data show that RNA decay by ribonuclease L (RNase L) has an important role in homeostasis and serves as a suppressor of cell adhesion.
26656695 Tanslation of vaccinia virus A27L and B5R genes is independent of PKR activation, but their expression is dependent on the RNase L activity.
26517238 Suggest that naturally occurring mutations in the RNase L gene might promote enhanced prostate cancer cell migration and metastasis.
26263979 Our results demonstrate a novel role of RNase L generated small RNAs in cross-talk between autophagy and apoptosis that impacts the fate of cells during viral infections and cancer.
26236721 Among 794 RNASEL Ssingle nucleotide polymorphism (SNPs) entries 124 SNPs were found nonsynonymous (ns) from which SIFT predicted 13 nsSNPs as nontolerable whereas PolyPhen-2 predicted 28.
25540362 These data show that RNase L targets specific sites in both host and viral RNAs to restrict influenza virus replication when NS1 protein is disabled.
25352621 Virus infection and RNase L activation disrupt its association with Filamin A and release RNase L to mediate its canonical nuclease-dependent antiviral activities.
More...

AA Sequence

MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMS      1 - 70
REDIVELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKA     71 - 140
LKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHAL    141 - 210
LSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLA    211 - 280
VELKLKKIAELLCKRGASTDCGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDL    281 - 350
HRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTF    351 - 420
YGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQN    421 - 490
ILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETK    491 - 560
DLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFD    561 - 630
KWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLV    631 - 700
IYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC                                 701 - 741
//

Text Mined References (133)

PMID Year Title
26858407 2016 Activation of RNase L is dependent on OAS3 expression during infection with diverse human viruses.
26771888 2016 Key genes involved in the immune response are generally not associated with intraprostatic inflammation in men without a prostate cancer diagnosis: Results from the prostate cancer prevention trial.
26760998 2016 The Roles of RNase-L in Antimicrobial Immunity and the Cytoskeleton-Associated Innate Response.
26668391 2015 Human RNase L tunes gene expression by selectively destabilizing the microRNA-regulated transcriptome.
26656695 2015 Suppression of NYVAC Infection in HeLa Cells Requires RNase L but Is Independent of Protein Kinase R Activity.
26517238 2015 RNase L is a negative regulator of cell migration.
26263979 2015 RNase L Cleavage Products Promote Switch from Autophagy to Apoptosis by Caspase-Mediated Cleavage of Beclin-1.
26236721 2015 Functional and Structural Consequences of Damaging Single Nucleotide Polymorphisms in Human Prostate Cancer Predisposition Gene RNASEL.
25540362 2015 RNase L targets distinct sites in influenza A virus RNAs.
25352621 2014 RNase L interacts with Filamin A to regulate actin dynamics and barrier function for viral entry.
More...