Property Summary

NCBI Gene PubMed Count 59
PubMed Score 737.99
PubTator Score 73.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count P-value
juvenile dermatomyositis 1187 3.0e-11
ovarian cancer 8520 4.0e-09
Duchenne muscular dystrophy 601 3.4e-08
Breast cancer 3578 2.0e-06
malignant mesothelioma 3232 1.0e-05
glioblastoma 5792 1.1e-05
medulloblastoma, large-cell 6241 1.1e-05
psoriasis 6694 3.0e-05
osteosarcoma 7950 5.9e-05
cystic fibrosis 1696 6.4e-05
Amyotrophic lateral sclerosis 451 8.4e-05
lung adenocarcinoma 2716 1.6e-04
pancreatic carcinoma 562 1.8e-04
pancreatic cancer 2398 1.8e-04
gastric cancer 459 3.4e-04
acute quadriplegic myopathy 1158 7.9e-04
pituitary cancer 1972 9.5e-04
urothelial carcinoma 318 1.0e-03
nasopharyngeal carcinoma 1058 1.4e-03
Pick disease 1894 2.6e-03
astrocytic glioma 2597 2.8e-03
oligodendroglioma 2850 2.8e-03
subependymal giant cell astrocytoma 2287 3.1e-03
adult high grade glioma 3801 3.4e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 510 4.3e-03
invasive ductal carcinoma 2951 5.0e-03
intraductal papillary-mucinous carcinoma (IPMC) 2989 5.9e-03
atypical teratoid / rhabdoid tumor 5112 7.3e-03
dermatomyositis 966 7.6e-03
mucosa-associated lymphoid tissue lymphoma 484 7.9e-03
colon cancer 1478 8.6e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 8.7e-03
pterygium 76 9.1e-03
interstitial cystitis 2312 9.5e-03
primitive neuroectodermal tumor 3035 1.2e-02
hereditary spastic paraplegia 318 1.4e-02
hepatocellular carcinoma 547 1.5e-02
intraductal papillary-mucinous neoplasm (IPMN) 3291 1.6e-02
group 4 medulloblastoma 1855 1.6e-02
interstitial lung disease 298 1.6e-02
Astrocytoma, Pilocytic 3081 1.7e-02
adrenocortical carcinoma 1428 2.0e-02
ulcerative colitis 1819 3.2e-02
pancreatic ductal adenocarcinoma liver metastasis 1962 3.8e-02
head and neck cancer 271 4.0e-02
ependymoma 4679 5.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (46)

Disease log2 FC p
acute quadriplegic myopathy 1.171 7.9e-04
adrenocortical carcinoma -1.010 2.0e-02
adult high grade glioma 2.000 3.4e-03
Amyotrophic lateral sclerosis 1.172 8.4e-05
astrocytic glioma 1.700 2.8e-03
Astrocytoma, Pilocytic 1.300 1.7e-02
atypical teratoid / rhabdoid tumor 1.400 7.3e-03
autosomal dominant Emery-Dreifuss muscul... 1.569 4.3e-03
Breast cancer -1.600 2.0e-06
colon cancer -1.400 8.6e-03
cystic fibrosis -1.983 6.4e-05
dermatomyositis 1.800 7.6e-03
Duchenne muscular dystrophy 1.798 3.4e-08
ependymoma 1.800 5.0e-02
gastric cancer 2.200 3.4e-04
glioblastoma 2.100 1.1e-05
group 4 medulloblastoma 1.300 1.6e-02
head and neck cancer -1.900 4.0e-02
hepatocellular carcinoma 1.300 1.5e-02
hereditary spastic paraplegia -1.134 1.4e-02
interstitial cystitis 1.100 9.5e-03
interstitial lung disease 1.200 1.6e-02
intraductal papillary-mucinous adenoma (... -1.400 8.7e-03
intraductal papillary-mucinous carcinoma... -1.700 5.9e-03
intraductal papillary-mucinous neoplasm ... -1.800 1.6e-02
invasive ductal carcinoma -1.100 5.0e-03
juvenile dermatomyositis 1.631 3.0e-11
lung adenocarcinoma -1.100 1.6e-04
malignant mesothelioma -1.100 1.0e-05
medulloblastoma, large-cell 2.200 1.1e-05
mucosa-associated lymphoid tissue lympho... 1.528 7.9e-03
nasopharyngeal carcinoma 1.500 1.4e-03
oligodendroglioma 1.500 2.8e-03
osteosarcoma 3.314 5.9e-05
ovarian cancer -2.000 4.0e-09
pancreatic cancer 1.400 1.8e-04
pancreatic carcinoma 1.400 1.8e-04
pancreatic ductal adenocarcinoma liver m... -1.310 3.8e-02
Pick disease 1.100 2.6e-03
pituitary cancer -1.100 9.5e-04
primitive neuroectodermal tumor 1.100 1.2e-02
psoriasis -1.200 3.0e-05
pterygium 1.200 9.1e-03
subependymal giant cell astrocytoma 2.023 3.1e-03
ulcerative colitis 1.100 3.2e-02
urothelial carcinoma 3.000 1.0e-03

Gene RIF (34)

AA Sequence

MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNA      1 - 70
QNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQND     71 - 140
TAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQVEV    141 - 210
MVEEKTTESQEETVVMSLKNGQISSEEPKQEEEREQGSDEISHHEKMEEEDKERAEAERARLEAEERERI    211 - 280
KAEQDKKIADERARIEAEEKAAAQERERREAEERERMREEEKRAAEERQRIKEEEKRAAEERQRIKEEEK    281 - 350
RAAEERQRIKEEEKRAAEERQRARAEEEEKAKVEEQKRNKQLEEKKHAMQETKIKGEKVEQKIEGKWVNE    351 - 420
KKAQEDKLQTAVLKKQGEEKGTKVQAKREKLQEDKPTFKKEEIKDEKIKKDKEPKEEVKSFMDRKKGFTE    421 - 490
VKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQE    491 - 560
AALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD    561 - 630
KKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAAS    631 - 700
DLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPG    701 - 770
DVSSKRNLWEKQSVDKVTSPTKV                                                   771 - 793
//

Text Mined References (70)

PMID Year Title