Property Summary

NCBI Gene PubMed Count 57
Grant Count 318
R01 Count 203
Funding $50,713,706.51
PubMed Score 801.50
PubTator Score 73.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (61)

Disease Z-score Confidence
Leiomyoma 25 5.21 2.6
Smooth muscle tumor 12 4.469 2.2
Cancer 2,346 4.403 2.2
Pseudosarcomatous fibromatosis 10 4.335 2.2
Fibroma 16 3.72 1.9
Primary cutaneous amyloidosis 26 3.606 1.8
Cervical polyp 2 3.542 1.8
Vulvar leiomyoma 2 3.527 1.8
Myoepithelioma 12 3.341 1.7
Nephrogenic adenofibroma 4 3.317 1.7
Osteoblastoma 8 3.243 1.6
Breast myofibroblastoma 2 3.231 1.6
Gastric leiomyoma 3 3.028 1.5
Amyotrophic Lateral Sclerosis 431
Breast cancer 3,094
Duchenne muscular dystrophy 602
Juvenile arthritis 124
Pick disease 1,893
Rheumatoid Arthritis 1,160
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
colon cancer 1,475
cystic fibrosis 1,665
dermatomyositis 933
gastric cancer 430
glioblastoma 5,572
head and neck cancer 270
hepatocellular carcinoma 532
hereditary spastic paraplegia 313
interstitial cystitis 2,299
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
nasopharyngeal carcinoma 1,056
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
pterygium 74
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

  Differential Expression (46)

Disease log2 FC p
gastric cancer 2.200 0.000
hepatocellular carcinoma 1.300 0.015
pancreatic cancer 3.100 0.000
interstitial lung disease 1.200 0.016
urothelial carcinoma 3.800 0.000
malignant mesothelioma -1.200 0.000
astrocytic glioma 1.700 0.003
posterior fossa group A ependymoma 2.300 0.000
oligodendroglioma 1.500 0.003
psoriasis -2.600 0.001
glioblastoma 2.600 0.000
osteosarcoma 3.314 0.000
sonic hedgehog group medulloblastoma 2.400 0.000
cystic fibrosis -2.618 0.000
atypical teratoid / rhabdoid tumor 2.500 0.000
medulloblastoma, large-cell 2.200 0.000
primitive neuroectodermal tumor 1.500 0.000
Duchenne muscular dystrophy 1.798 0.000
autosomal dominant Emery-Dreifuss muscul... 1.569 0.004
hereditary spastic paraplegia -1.134 0.014
juvenile dermatomyositis 1.631 0.000
Amyotrophic Lateral Sclerosis 1.172 0.000
acute quadriplegic myopathy 1.171 0.001
adrenocortical carcinoma -1.123 0.013
primary pancreatic ductal adenocarcinoma 3.180 0.000
intraductal papillary-mucinous adenoma (... -2.400 0.004
intraductal papillary-mucinous carcinoma... -2.700 0.009
intraductal papillary-mucinous neoplasm ... -2.200 0.014
colon cancer -2.600 0.001
interstitial cystitis 1.100 0.009
pediatric high grade glioma 2.500 0.000
pilocytic astrocytoma 1.300 0.013
pancreatic carcinoma 2.400 0.000
subependymal giant cell astrocytoma 2.223 0.034
lung adenocarcinoma 1.641 0.000
nasopharyngeal carcinoma 1.800 0.000
Pick disease 1.100 0.003
Breast cancer -2.200 0.000
pterygium 1.200 0.009
mucosa-associated lymphoid tissue lympho... 1.528 0.008
invasive ductal carcinoma -1.100 0.005
ulcerative colitis 1.700 0.004
ovarian cancer -3.500 0.000
pituitary cancer -1.600 0.004
dermatomyositis 1.800 0.008
head and neck cancer -1.900 0.040

Synonym

Accession Q05682 A8K0X1 Q13978 Q13979 Q14741 Q14742 Q9UD91 CDM
Symbols CDM
HCAD
LCAD
H-CAD
L-CAD
NAG22

Gene

Gene RIF (32)

PMID Text
26430961 Data indicate that low-molecular-weight caldesmon isoforms (L-CAD) promotes migration and invasiveness of urothelial bladder carcinoma (BC) cells.
24551305 Caldesmon and smoothelin staining allows better delineation of the muscularis propria from the desmoplastic stromal reaction which provides a critical aide for proper staging of colonic adenocarcinomas.
23575144 Caldesmon is a possible predictor of endometrial dysregulation in patients with endometriosis.
23418348 The data suggest that PKGIbeta enhances breast cancer cell motility and invasive capacity, at least in part, by phosphorylating CaD.
23265641 Caldesmon expression inhibits cancer cell migration and invasiveness.
23196794 caldesmon is not useful in distinguishing between peritoneal epithelioid mesotheliomas and papillary serous carcinomas involving the peritoneum
22316291 Disruption of the normal inhibitory function of human caldesmon 1 enhances intestinal peristalsis in both wild-type zebrafish larvae and mutant larvae that lack enteric nerves
21738699 Data found phasic phosphorylation of caldesmon and ERK 1/2 during contractions in human myometrium.
21626272 Our results show a differential behavior of h- and l-caldesmon isoforms in epithelium and stroma of colon adenocarcinoma and lymph node metastases.
21184254 Novel biological cascade that involved the phosphorylation activation of CaD by PFTK1 kinase in promoting formation of actin stress fibers.
More...

AA Sequence

MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNA      1 - 70
QNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQND     71 - 140
TAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQVEV    141 - 210
MVEEKTTESQEETVVMSLKNGQISSEEPKQEEEREQGSDEISHHEKMEEEDKERAEAERARLEAEERERI    211 - 280
KAEQDKKIADERARIEAEEKAAAQERERREAEERERMREEEKRAAEERQRIKEEEKRAAEERQRIKEEEK    281 - 350
RAAEERQRIKEEEKRAAEERQRARAEEEEKAKVEEQKRNKQLEEKKHAMQETKIKGEKVEQKIEGKWVNE    351 - 420
KKAQEDKLQTAVLKKQGEEKGTKVQAKREKLQEDKPTFKKEEIKDEKIKKDKEPKEEVKSFMDRKKGFTE    421 - 490
VKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQE    491 - 560
AALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD    561 - 630
KKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAAS    631 - 700
DLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPG    701 - 770
DVSSKRNLWEKQSVDKVTSPTKV                                                   771 - 793
//

Text Mined References (67)

PMID Year Title
26430961 2015 Overexpression of caldesmon is associated with tumor progression in patients with primary non-muscle-invasive bladder cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24551305 2014 Smoothelin and caldesmon are reliable markers for distinguishing muscularis propria from desmoplasia: a critical distinction for accurate staging colorectal adenocarcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23575144 2013 Caldesmon: new insights for diagnosing endometriosis.
23418348 2013 cGMP-dependent protein kinase I? regulates breast cancer cell migration and invasion via interaction with the actin/myosin-associated protein caldesmon.
23265641 2013 Identification and functional validation of caldesmon as a potential gastric cancer metastasis-associated protein.
23196794 2013 Value of PAX8, PAX2, claudin-4, and h-caldesmon immunostaining in distinguishing peritoneal epithelioid mesotheliomas from serous carcinomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...