Property Summary

NCBI Gene PubMed Count 540
Grant Count 118
R01 Count 77
Funding $13,873,753.59
PubMed Score 132.25
PubTator Score 1972.93

Knowledge Summary

Patent (7,423)

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.100 0.006
oligodendroglioma -1.300 0.001
osteosarcoma -2.070 0.000
group 3 medulloblastoma -1.400 0.009
medulloblastoma, large-cell -1.200 0.008
lung cancer -1.100 0.034
interstitial cystitis -1.200 0.002
atypical teratoid/rhabdoid tumor -1.200 0.000
lung carcinoma -1.300 0.000
acute myeloid leukemia 2.300 0.041

Synonym

Accession Q05655 B0KZ81 B2R834 Q15144 Q86XJ6
Symbols MAY1
PKCD
ALPS3
CVID9
nPKC-delta

Gene

PDB

1YRK   2YUU  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (416)

PMID Text
26821209 Docosahexaenoic acid increase the efficacy of docetaxel in mammary cancer cells by downregulating Akt and PKCepsilon/delta-induced ERK pathways.
26808499 Persistent PRKCD elevation in fibroblasts from diabetic patients inhibits insulin signaling and function to impair wound healing.
26668311 Data suggest that cytokines (TNF-alpha, IL1-beta, IFN-gamma) disrupt gap junction coupling in pancreatic islets under conditions associated with prediabetes; the mechanism appears to involve nitric oxide-mediated activation of protein kinase C-delta.
26546672 Phosphorylation site at Ser130 adjacent to the pseudosubstrate domain contributes to the activation of protein kinase.
26522132 Study shows that PRKCD influences corticotroph cell viability, POMC and ACTH expression suggesting that PRKCD plays an important role in restraining corticotroph cell proliferation and function.
26300055 The results suggest that PKC-delta is an essential part of the apoptotic program in mesothelioma cells, whereas PKC-alpha mediates a pro-survival response to cisplatin.
26218882 PKCzeta Promotes Breast Cancer Invasion by Regulating Expression of E-cadherin and Zonula Occludens-1 (ZO-1) via NFkappaB-p65
26121314 Gene fusions involving PRKC genes occur in several morphological and clinical subsets of benign fibrous histiocytoma, but they seem to account for only a minority of the cases.
26017369 PKC-delta is a crucial factor in the heat sensitivity and thermal resistance of tongue squamous carcinoma cells.
26015399 K-Ras stabilization by estrogen via PKCdelta has a role in endometrial tumorigenesis
More...

AA Sequence

MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQ      1 - 70
IVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFP     71 - 140
TMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTG    141 - 210
TAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC    211 - 280
GINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFI    281 - 350
FHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK    351 - 420
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIA    421 - 490
DFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESI    491 - 560
RVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDY    561 - 630
SNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED                            631 - 676
//

Text Mined References (562)

PMID Year Title
26821209 2016 Long chain n-3 polyunsaturated fatty acids increase the efficacy of docetaxel in mammary cancer cells by downregulating Akt and PKC?/?-induced ERK pathways.
26808499 2016 PKC? inhibition normalizes the wound-healing capacity of diabetic human fibroblasts.
26668311 2016 Low Level Pro-inflammatory Cytokines Decrease Connexin36 Gap Junction Coupling in Mouse and Human Islets through Nitric Oxide-mediated Protein Kinase C?.
26546672 2016 A novel phosphorylation site at Ser130 adjacent to the pseudosubstrate domain contributes to the activation of protein kinase C-?.
26522132 2016 Protein Kinase C Delta restrains growth in ACTH-secreting pituitary adenoma cells.
26300055 2015 PKC-?/PKC-? activity balance regulates the lethal effects of cisplatin.
26218882 2015 PKC? Promotes Breast Cancer Invasion by Regulating Expression of E-cadherin and Zonula Occludens-1 (ZO-1) via NF?B-p65.
26121314 2015 Gene fusion detection in formalin-fixed paraffin-embedded benign fibrous histiocytomas using fluorescence in situ hybridization and RNA sequencing.
26112605 2015 PKC? stabilizes TAp63 to promote cell apoptosis.
26017369 2015 Identification of proteins interacting with protein kinase C-? in hyperthermia-induced apoptosis and thermotolerance of Tca8113 cells.
More...