Property Summary

NCBI Gene PubMed Count 56
Grant Count 213
R01 Count 96
Funding $21,916,544.35
PubMed Score 335.37
PubTator Score 1020.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
astrocytoma -2.100 0.000
posterior fossa group A ependymoma -3.900 0.000
glioblastoma -2.100 0.007
oligodendroglioma -1.800 0.000
sonic hedgehog group medulloblastoma -2.800 0.000
atypical teratoid/rhabdoid tumor -3.100 0.000
interstitial cystitis -1.100 0.007
pediatric high grade glioma -2.000 0.004
lung adenocarcinoma 1.700 0.001
lung carcinoma 2.000 0.000
breast carcinoma 1.700 0.000
Breast cancer 1.300 0.001
invasive ductal carcinoma 2.100 0.050
dermatomyositis -1.600 0.003

Synonym

Accession Q05639 B5BUF3 E1P5J1 P54266 Q0VGC7 EF-1-alpha-2
Symbols HS1
STN
EF1A
STNL
MRD38
EEF1AL
EIEE33
EF-1-alpha-2

Gene

PDB

3C5J  

Gene RIF (36)

PMID Text
26212729 Our results provide novel information on the intracellular distribution and interaction of eEF1A isoforms.
25744894 By directly targeting eEF1A2.
25601347 Overexpression of eEF1A2 was correlated with worse outcomes in gastric cancer patients, suggesting its critical roles in the carcinogenesis of gastric cancer.
25436608 Both eEF1A1 and eEF1A2 colocalise with all eEF1B subunits, in such close proximity that they are highly likely to be in a complex.
25394965 Finally, a strong association between the expression of EEF1A2, phosphorylated AKT and MDM4 was observed in human HCC samples. Strong activation of the EEF1A2/PI3K/AKT/mTOR/MDM4 signaling pathway was observed in HCC patients
24853801 Our data suggests that eEF1A2 plays an important role in prostate cancer development, especially in inhibiting apoptosis.
24697219 De novo EEF1A2 mutations in patients with characteristic facial features, intellectual disability, autistic behaviors and epilepsy.
24510995 There was no significant correlation between eEF1A2 protein and mRNA expression levels. Negative immunostaining of eEF1A2 predicted for poor prognosis of NSCLC.
24285179 The activation level of the EEF1A2/PI3K/AKT/mTOR/MDM4 axis significantly influences the survival probability of hepatocellular carcinoma patients
23739844 results provide evidence of eEF1A2 as a potential therapeutic target in the treatment of aggressive pancreatic cancer
More...

AA Sequence

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG      1 - 70
ITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA     71 - 140
YTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPW    141 - 210
FKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTF    211 - 280
APVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHP    281 - 350
GQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPP    351 - 420
LGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK                               421 - 463
//

Text Mined References (63)

PMID Year Title
26212729 2015 New insights on the interaction between the isoforms 1 and 2 of human translation elongation factor 1A.
25744894 2015 miR-663 attenuates tumor growth and invasiveness by targeting eEF1A2 in pancreatic cancer.
25601347 2015 Overexpression of eukaryotic elongation factor 1 alpha-2 is associated with poorer prognosis in patients with gastric cancer.
25436608 2014 Characterisation of translation elongation factor eEF1B subunit expression in mammalian cells and tissues and co-localisation with eEF1A2.
25416956 2014 A proteome-scale map of the human interactome network.
25394965 2014 [EEF1A2 inhibits the p53 function in hepatocellular carcinoma via PI3K/AKT/mTOR-dependent stabilization of MDM4].
24853801 2014 Up-regulation of eEF1A2 promotes proliferation and inhibits apoptosis in prostate cancer.
24697219 2015 De novo EEF1A2 mutations in patients with characteristic facial features, intellectual disability, autistic behaviors and epilepsy.
24510995 2014 The prognostic significance of eukaryotic elongation factor 1 alpha-2 in non-small cell lung cancer.
24285179 2014 EEF1A2 inactivates p53 by way of PI3K/AKT/mTOR-dependent stabilization of MDM4 in hepatocellular carcinoma.
More...