Property Summary

Ligand Count 3
NCBI Gene PubMed Count 60
PubMed Score 360.01
PubTator Score 1020.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.900 2.3e-03
astrocytic glioma -1.600 2.1e-02
atypical teratoid / rhabdoid tumor -2.600 1.4e-04
Breast cancer 1.300 7.5e-04
breast carcinoma 1.700 2.5e-12
dermatomyositis -1.600 3.3e-03
ependymoma -2.100 4.2e-02
glioblastoma -1.900 2.1e-04
group 3 medulloblastoma -2.400 9.0e-04
interstitial cystitis -1.100 7.3e-03
invasive ductal carcinoma 2.100 5.0e-02
lung adenocarcinoma 1.700 1.4e-03
lung carcinoma 2.000 2.4e-44
malignant mesothelioma 2.000 5.0e-07
oligodendroglioma -1.800 1.0e-13

Protein-protein Interaction (6)

Gene RIF (40)

AA Sequence

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG      1 - 70
ITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA     71 - 140
YTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPW    141 - 210
FKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTF    211 - 280
APVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHP    281 - 350
GQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPP    351 - 420
LGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK                               421 - 463
//

Text Mined References (69)

PMID Year Title