Property Summary

NCBI Gene PubMed Count 153
Grant Count 764
R01 Count 438
Funding $99,237,196.39
PubMed Score 650.67
PubTator Score 752.04

Knowledge Summary

Patent (41,465)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -1.600 0.000
glioblastoma -2.400 0.000
oligodendroglioma -1.700 0.000
osteosarcoma 1.643 0.000
posterior fossa group A ependymoma -2.700 0.000
medulloblastoma -2.600 0.000
atypical teratoid/rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -1.200 0.003
primitive neuroectodermal tumor -1.600 0.000
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -2.600 0.000
non primary Sjogren syndrome sicca 1.300 0.017
subependymal giant cell astrocytoma -2.118 0.005
lung adenocarcinoma 1.100 0.000
Pick disease -1.700 0.001

Synonym

Accession Q05586 A6NLK7 A6NLR1 C9K0X1 P35437 Q12867 Q12868 Q5VSF3 Q5VSF4 Q5VSF5 Q5VSF6 Q5VSF7 Q5VSF8 Q9UPF8 Q9UPF9 GluN1
Symbols NR1
MRD8
GluN1
NMDA1
NMD-R1
NMDAR1

Gene

PDB

5H8F   5H8H   5H8N   5H8Q   5I2K   5I2N   5KCJ   5KDT   3BYA   2HQW   2NR1  

  TechDev Info (1)

Susumu Tomita Examining potential modulators

 IMPC Term (1)

Gene RIF (146)

PMID Text
26819771 GRIN1 (rs4880213) was significantly associated with depression and disruptive behavior in adolescents.
26584860 Knockdown of PKD1 did not affect NMDAR internalization but prevented the phosphorylation and inhibition of remaining surface NMDARs and NMDAR-mediated synaptic functions.
25864721 The results of this study suggested that GRIN1 mutations cause encephalopathy resulting in seizures and movement disorders.
25760043 The gene expression of GRIN1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25613138 The gene expression of GRIN1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25431428 results suggest that NMDA-R autoantibodies are unlikely to account for a large proportion of treatment-refractory psychosis.
25261450 Study found GluN receptor subunit-specific changes in mixed subcortical ischemic vascular dementia(SIVD)/Alzheimer's disease(AD) (decreased GluN1) and SIVD (increased GluN2A and 2B), likely reflecting interaction of ischemic neurovascular and AD processes
25232120 The gene expression of GRIN1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25017909 Isolated GluN1/GluN3A receptors integrated into lipid bilayers responded to addition of either glycine or d-serine, but not glutamate, with a approximately 1 nm reduction in height of the extracellular domain
24739951 The gene expression of GRIN1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
More...

AA Sequence

MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPN      1 - 70
AIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRT     71 - 140
VPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERESKAEKVLQFDPGTKNVTALLME    141 - 210
AKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAH    211 - 280
ISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFAN    281 - 350
YSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC    351 - 420
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERV    421 - 490
NNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQS    491 - 560
TLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSAR    561 - 630
ILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELS    631 - 700
TMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQ    701 - 770
NVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH    771 - 840
KDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQ    841 - 910
NQKDTVLPRRAIEREEGQLQLCSRHRES                                              911 - 938
//

Text Mined References (157)

PMID Year Title
26819771 2016 Influence of Genetic Variants of the N-Methyl-D-Aspartate Receptor on Emotion and Social Behavior in Adolescents.
26584860 2015 Regulated internalization of NMDA receptors drives PKD1-mediated suppression of the activity of residual cell-surface NMDA receptors.
25864721 2015 GRIN1 mutations cause encephalopathy with infantile-onset epilepsy, and hyperkinetic and stereotyped movement disorders.
25431428 2015 Prevalence of serum N-methyl-D-aspartate receptor autoantibodies in refractory psychosis.
25261450 2015 Differential alterations of neocortical GluN receptor subunits in patients with mixed subcortical ischemic vascular dementia and Alzheimer's disease.
25017909 2014 Activation-induced structural change in the GluN1/GluN3A excitatory glycine receptor.
24655651 2014 Child abuse, depression, and methylation in genes involved with stress, neural plasticity, and brain circuitry.
24292102 2014 Changes of several brain receptor complexes in the cerebral cortex of patients with Alzheimer disease: probable new potential pharmaceutical targets.
24227730 2013 The ?-1 receptor interacts directly with GluN1 but not GluN2A in the GluN1/GluN2A NMDA receptor.
24156266 2014 Pathological reorganization of NMDA receptors subunits and postsynaptic protein PSD-95 distribution in Alzheimer's disease.
More...