Property Summary

Ligand Count 58
NCBI Gene PubMed Count 167
PubMed Score 693.12
PubTator Score 752.04

Knowledge Summary

Patent (41,465)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.100 7.9e-04
astrocytoma -1.500 5.9e-22
Astrocytoma, Pilocytic -2.700 1.1e-08
atypical teratoid / rhabdoid tumor -1.500 3.3e-06
ependymoma -2.600 1.8e-16
glioblastoma -2.400 1.1e-10
group 3 medulloblastoma -2.500 1.3e-03
lung adenocarcinoma 1.100 1.1e-04
medulloblastoma, large-cell -1.200 3.2e-03
non primary Sjogren syndrome sicca 1.300 1.7e-02
oligodendroglioma -1.500 4.5e-19
osteosarcoma 1.044 6.2e-05
Pick disease -1.200 2.2e-03
primitive neuroectodermal tumor -1.600 2.4e-04
subependymal giant cell astrocytoma -1.830 8.1e-03

Protein-protein Interaction (1)

Gene RIF (152)

AA Sequence

MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPN      1 - 70
AIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRT     71 - 140
VPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERESKAEKVLQFDPGTKNVTALLME    141 - 210
AKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAH    211 - 280
ISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFAN    281 - 350
YSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC    351 - 420
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERV    421 - 490
NNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQS    491 - 560
TLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSAR    561 - 630
ILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELS    631 - 700
TMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQ    701 - 770
NVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH    771 - 840
KDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQ    841 - 910
NQKDTVLPRRAIEREEGQLQLCSRHRES                                              911 - 938
//

Text Mined References (175)

PMID Year Title