Property Summary

NCBI Gene PubMed Count 23
Grant Count 15
R01 Count 15
Funding $865,277.84
PubMed Score 2.04
PubTator Score 5.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Gene RIF (4)

PMID Text
24657192 1p31 SFRS11 v
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18832053 The G2/M arrest induced by MIAs is required for p54(nrb) phosphorylation. CDK activity is required for MIA-induced phosphorylation of p54(nrb).
16943417 SRp54 interacts with a purine-rich element tau in exon 10 and antagonizes Tra2beta, an SR-domain-containing protein that enhances exon 10 inclusion.

AA Sequence

MSNTTVVPSTAGPGPSGGPGGGGGGGGGGGGTEVIQVTNVSPSASSEQMRTLFGFLGKIDELRLFPPDDS      1 - 70
PLPVSSRVCFVKFHDPDSAVVAQHLTNTVFVDRALIVVPYAEGVIPDEAKALSLLAPANAVAGLLPGGGL     71 - 140
LPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPSL    141 - 210
KSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSRSRRRRTPSSSRHRRSRSRSRRRSHSK    211 - 280
SRSRRRSKSPRRRRSHSRERGRRSRSTSKTRDKKKEDKEKKRSKTPPKSYSTARRSRSASRERRRRRSRS    281 - 350
GTRSPKKPRSPKRKLSRSPSPRRHKKEKKKDKDKERSRDERERSTSKKKKSKDKEKDRERKSESDKDVKQ    351 - 420
VTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD          421 - 484
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24657192 2014 Regulation of gene expression programmes by serine-arginine rich splicing factors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...