Property Summary

NCBI Gene PubMed Count 27
PubMed Score 2.09
PubTator Score 5.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.506 3.1e-06
astrocytic glioma 1.100 8.8e-03
Breast cancer -1.400 1.3e-10
breast carcinoma -1.200 8.0e-13
dermatomyositis 1.100 1.8e-03
ependymoma 1.300 2.6e-02
Gaucher disease type 1 -1.200 4.9e-02
glioblastoma -1.400 6.1e-05
intraductal papillary-mucinous adenoma (... 1.300 4.5e-03
intraductal papillary-mucinous carcinoma... 1.100 4.2e-03
invasive ductal carcinoma -1.300 1.0e-02
lung cancer -1.900 1.9e-02
non-small cell lung cancer -1.397 1.9e-19
oligodendroglioma -1.600 1.6e-03
osteosarcoma -2.095 4.7e-05
ovarian cancer -1.600 4.3e-05
pancreatic ductal adenocarcinoma liver m... 1.030 2.1e-02
Pick disease 1.500 1.5e-03
progressive supranuclear palsy -1.100 2.9e-02
psoriasis -1.700 2.7e-03
tuberculosis and treatment for 6 months 1.100 1.2e-03

Gene RIF (4)

AA Sequence

MSNTTVVPSTAGPGPSGGPGGGGGGGGGGGGTEVIQVTNVSPSASSEQMRTLFGFLGKIDELRLFPPDDS      1 - 70
PLPVSSRVCFVKFHDPDSAVVAQHLTNTVFVDRALIVVPYAEGVIPDEAKALSLLAPANAVAGLLPGGGL     71 - 140
LPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPSL    141 - 210
KSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSRSRRRRTPSSSRHRRSRSRSRRRSHSK    211 - 280
SRSRRRSKSPRRRRSHSRERGRRSRSTSKTRDKKKEDKEKKRSKTPPKSYSTARRSRSASRERRRRRSRS    281 - 350
GTRSPKKPRSPKRKLSRSPSPRRHKKEKKKDKDKERSRDERERSTSKKKKSKDKEKDRERKSESDKDVKQ    351 - 420
VTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD          421 - 484
//

Text Mined References (40)

PMID Year Title