Property Summary

NCBI Gene PubMed Count 125
Grant Count 133
R01 Count 88
Funding $12,987,940.72
PubMed Score 194.53
PubTator Score 177.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q05516 Q8TAL4
Symbols PLZF
ZNF145

Gene

PDB

1BUO   1CS3  

Gene RIF (80)

PMID Text
27035670 integration of PLZF ChIP-Seq and RNA Pol II RNA-Seq datasets revealed that the early growth response 1 (EGR1) transcription factor is a PLZF target for which its level of expression must be reduced to enable progesterone dependent hESC decidualization
26676652 Emerging evidence shows that PLZF regulates the balance of self-renewal and differentiation in stem cells.
26297253 These results support a prognostic value for loss of cytoplasmic PLZF expression in the stratification of non-small cell lung cancer and a possible role of cytoplasmic shift and down-regulation of PLZF in the pathogenesis of NSCLC.
26121690 NLRP7 is involved in Hydatidiform Molar Pregnancy (HYDM1) and interacts with the transcriptional repressor ZBTB16
25833398 PLZF regulates CCR6 and is critical for the acquisition and maintenance of the Th17 phenotype in human cells.
25808865 PLZF loss enhances castration-resistant prostate cancer tumor growth in a xenograft model.
25807461 down-regulation of PLZF is an important molecular process for prostate tumor progression
25705792 Authors found that PLZF mediates suppression of miR-146a to control increases of CXCR4 and TRAF6 protein levels in human primary CD4(+) T lymphocytes.
25369784 Down-regulation of PLZF in human hepatocellular carcinoma.PLZF expression was positively correlated with the alkaline phosphatase level in hepatocellular carcinoma patients.
25178676 Data suggest that interleukin-32alpha (IL-32alpha) associates with leukemia zinc finger (PLZF) and protein kinase c epsilon (PKCvarepsilon), and then inhibits PLZF sumoylation, resulting in suppression of the transcriptional activity of PLZF.
More...

AA Sequence

MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHY      1 - 70
TLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADG     71 - 140
GAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIG    141 - 210
QSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGP    211 - 280
GTPTRSSVITSARELHYGREESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPS    281 - 350
SVTSGLHVQPALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE    351 - 420
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDMAV    421 - 490
FCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDEST    491 - 560
LKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPY    561 - 630
QCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV                               631 - 673
//

Text Mined References (126)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27035670 2016 The Promyelocytic Leukemia Zinc Finger Transcription Factor Is Critical for Human Endometrial Stromal Cell Decidualization.
26676652 2016 Concise Review: Balancing Stem Cell Self-Renewal and Differentiation with PLZF.
26297253 2015 Down-regulation of cytoplasmic PLZF correlates with high tumor grade and tumor aggression in non-small cell lung carcinoma.
26121690 2015 NLRP7, Involved in Hydatidiform Molar Pregnancy (HYDM1), Interacts with the Transcriptional Repressor ZBTB16.
25833398 2015 PLZF regulates CCR6 and is critical for the acquisition and maintenance of the Th17 phenotype in human cells.
25808865 2015 PLZF, a tumor suppressor genetically lost in metastatic castration-resistant prostate cancer, is a mediator of resistance to androgen deprivation therapy.
25807461 2015 Loss of PLZF expression in prostate cancer by immunohistochemistry correlates with tumor aggressiveness and metastasis.
25705792 2015 miR-146a controls CXCR4 expression in a pathway that involves PLZF and can be used to inhibit HIV-1 infection of CD4(+) T lymphocytes.
25416956 2014 A proteome-scale map of the human interactome network.
More...