Property Summary

Ligand Count 13
NCBI Gene PubMed Count 274
PubMed Score 126.86
PubTator Score 338.20

Knowledge Summary

Patent (8,563)


  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -3.100 2.9e-07
astrocytic glioma -2.500 3.7e-03
Astrocytoma, Pilocytic -2.200 5.0e-10
atypical teratoid / rhabdoid tumor -3.000 9.8e-10
ductal carcinoma in situ 1.400 7.4e-03
ependymoma -2.400 4.2e-03
glioblastoma -2.900 2.3e-09
group 3 medulloblastoma -3.800 6.7e-07
invasive ductal carcinoma 1.600 2.3e-02
lung adenocarcinoma -1.100 1.4e-05
malignant mesothelioma 2.300 9.9e-06
medulloblastoma, large-cell -4.100 1.2e-06
non-small cell lung cancer -1.395 7.2e-19
oligodendroglioma -1.600 2.2e-02
osteosarcoma -1.604 1.3e-02
ovarian cancer 1.700 3.8e-06
pituitary cancer -1.100 2.0e-05
primitive neuroectodermal tumor -2.400 7.0e-08
psoriasis 1.700 6.2e-05
spina bifida -1.932 4.9e-02
subependymal giant cell astrocytoma -3.698 4.5e-02

Protein-protein Interaction (10)

Gene RIF (192)

AA Sequence

PDDEDAIKRIDQSEFEGFEYINPLLLSTEESV                                          561 - 592

Text Mined References (288)

PMID Year Title