Property Summary

NCBI Gene PubMed Count 269
Grant Count 191
R01 Count 141
Funding $13,716,934.05
PubMed Score 112.88
PubTator Score 338.20

Knowledge Summary

Patent (8,563)

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
astrocytoma -3.000 0.002
posterior fossa group A ependymoma -3.800 0.000
oligodendroglioma -2.100 0.000
psoriasis 1.700 0.000
glioblastoma -3.800 0.000
osteosarcoma -1.604 0.013
group 4 medulloblastoma -4.200 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -4.100 0.000
primitive neuroectodermal tumor -2.400 0.000
non-small cell lung cancer -1.395 0.000
pediatric high grade glioma -3.400 0.000
pilocytic astrocytoma -2.200 0.000
subependymal giant cell astrocytoma -3.698 0.045
lung adenocarcinoma -1.100 0.000
spina bifida -1.932 0.049
ductal carcinoma in situ 1.400 0.007
invasive ductal carcinoma 1.600 0.023
ovarian cancer 1.700 0.000
pituitary cancer -1.100 0.000

Synonym

Accession Q05513 A8K4N0 A8MU64 B7Z2J7 E9PCW2 Q15207 Q5SYT5 Q969S4
Symbols PKC2
PKC-ZETA

Gene

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (191)

PMID Text
27143478 FRET-based translocation assays reveal that insulin promotes the association of both p62 and aPKC with the insulin-regulated scaffold IRS-1.
26887939 data suggest that the interaction between this novel region in Galphaq and the effector PKCzeta is a key event in Galphaq signaling.
26711256 The PKC-zeta - induced phosphorylation of GSK-3 beta stimulates GSK-3 beta activity.
26187466 Data show that aPKC scaffold protein p62 tethers Atypical protein kinase C (aPKC) in an active conformation.
25874946 Over-expression of PRKCZ results in gene and/or protein expression alterations of insulin-like growth factor 1 receptor (IGF1R) and integrin beta 3 (ITGB3) in SKOV3 and OVCAR3 cells.
25817572 PKCzeta inhibition prevented alternative cleavage and release of TROP2, suggesting that these events require endocytic uptake and exosomal release of the corresponding microvesicles.
25075435 PRKCZ methylation is associated with sunlight exposure
25070947 Neuronal NF1/RAS regulation of cyclic AMP requires atypical PKC zeta activation, which is perturbed in neurofibromatosis type 1.
24990612 PKCzeta and PKMzeta are overexpressed in TCF3-rearranged paediatric acute lymphoblastic leukaemia and may have a role in thiopurine sensitivity
24920238 Results indicate that PKCzeta regulates survivin expression levels and inhibits apoptosis in colon cancer cells.
More...

AA Sequence

MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTV      1 - 70
SSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNR     71 - 140
RAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETD    141 - 210
GIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAM    211 - 280
KVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPE    281 - 350
EHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP    351 - 420
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLK    421 - 490
GFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLT    491 - 560
PDDEDAIKRIDQSEFEGFEYINPLLLSTEESV                                          561 - 592
//

Text Mined References (283)

PMID Year Title
27143478 2016 Protein Scaffolds Control Localized Protein Kinase C? Activity.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27040869 2016 Novel PKC-? to p47 phox interaction is necessary for transformation from blebbishields.
26887939 2016 Protein Kinase C ? Interacts with a Novel Binding Region of G?q to Act as a Functional Effector.
26711256 2015 Glycogen Synthase Kinase 3? Is Positively Regulated by Protein Kinase C?-Mediated Phosphorylation Induced by Wnt Agonists.
26187466 2015 Zeta Inhibitory Peptide Disrupts Electrostatic Interactions That Maintain Atypical Protein Kinase C in Its Active Conformation on the Scaffold p62.
25874946 2015 Atypical protein kinase C zeta: potential player in cell survival and cell migration of ovarian cancer.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25817572 2015 Differential regulation of TROP2 release by PKC isoforms through vesicles and ADAM17.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...