Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.81
PubTator Score 13.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.600 1.2e-03
astrocytoma -2.100 4.2e-03
Astrocytoma, Pilocytic -1.100 6.2e-04
dermatomyositis -1.200 2.0e-02
ductal carcinoma in situ 1.100 7.6e-03
ependymoma -1.200 1.0e-06
fascioscapulohumeral muscular dystrophy -1.155 1.8e-04
gastric cancer 1.200 1.3e-03
glioblastoma -1.200 7.0e-06
group 4 medulloblastoma 1.100 1.1e-02
hepatocellular carcinoma 1.500 1.8e-05
interstitial cystitis -1.700 1.9e-03
intraductal papillary-mucinous adenoma (... 1.100 3.4e-02
invasive ductal carcinoma -1.441 2.8e-03
malignant mesothelioma -3.900 7.0e-09
medulloblastoma, large-cell -1.400 8.9e-06
non-small cell lung cancer -1.099 1.9e-06
osteosarcoma 2.580 1.1e-05
ovarian cancer 2.000 2.8e-05
primary Sjogren syndrome 1.100 9.6e-04
psoriasis -1.400 1.7e-24
spina bifida -2.622 4.0e-02
ulcerative colitis -1.600 3.6e-08
Waldenstrons macroglobulinemia 1.038 2.2e-02

Gene RIF (1)

AA Sequence

MPGTPGSLEMGLLTFRDVAIEFSPEEWQCLDTAQQNLYRNVMLENYRNLAFLGIALSKPDLITYLEQGKE      1 - 70
PWNMKQHEMVDEPTGICPHFPQDFWPEQSMEDSFQKVLLRKYEKCGHENLQLRKGCKSVDECKVHKEGYN     71 - 140
KLNQCLTTAQSKVFQCGKYLKVFYKFLNSNRHTIRHTGKKCFKCKKCVKSFCIRLHKTQHKCVYITEKSC    141 - 210
KCKECEKTFHWSSTLTNHKEIHTEDKPYKCEECGKAFKQLSTLTTHKIICAKEKIYKCEECGKAFLWSST    211 - 280
LTRHKRIHTGEKPYKCEECGKAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKPY    281 - 350
KCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSN    351 - 420
LTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPY    421 - 490
KCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFKQFST    491 - 560
LTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTGEKPY    561 - 630
KCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLST    631 - 700
LTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPF    701 - 770
KCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSA    771 - 840
LAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTY    841 - 910
KCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSST    911 - 980
LTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKPY    981 - 1050
KCEECGKAFISSSTLNGHKRIHTREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFKESSA   1051 - 1120
LTKHKIIHTGEKPYKCEKCGKAFNQSSILTNHKKIHTITPVIPLLWEAEAGGSRGQEMETILANTVKPLL   1121 - 1190
Y//

Text Mined References (13)

PMID Year Title