Property Summary

NCBI Gene PubMed Count 94
Grant Count 134
R01 Count 86
Funding $14,993,858.1
PubMed Score 412.32
PubTator Score 308.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.500 0.001
Atopic dermatitis -1.100 0.030
breast carcinoma -2.900 0.001
fibroadenoma -3.800 0.004
group 3 medulloblastoma -1.100 0.036
subependymal giant cell astrocytoma -1.106 0.029
ductal carcinoma in situ -3.700 0.000
invasive ductal carcinoma -4.200 0.002
ovarian cancer 1.100 0.000

Synonym

Accession Q05469 Q3LRT2 Q6NSL7 HSL
Symbols HSL
LHS
AOMS4
FPLD6

Gene

Gene RIF (72)

PMID Text
25819461 Despite reductions in intramyocellular lipolysis and HSL expression, overexpression of HSL did not rescue defects in insulin action in skeletal myotubes from obese type 2 diabetic subjects.
25475467 Identification of a homozygous nonsense variant p.Ala507fsTer563 in hormone sensitive lipase as the likely cause of the lipodystrophy phenotype in siblings.
24848981 These findings indicate the physiological significance of HSL in adipocyte function and the regulation of systemic lipid and glucose homeostasis and underscore the severe metabolic consequences of impaired lipolysis.
23688034 Serum triglyceride was significantly up-regulated in men with the (CG + GG) genotype of HSL promoter polymorphism.
22553833 M. leprae suppresses lipid degradation through inhibition of HSL expression.
21933124 Enzyme promiscuity in the hormone-sensitive lipase family of proteins.
21919688 suggests that genetic variation of HSL may be a risk factor for male infertility
21826994 LIPE C-60G variation can inhibit the decrease of LDL-C and the increases of HDL-C and apo A-I in young healthy males, and can inhibit the decrease of LDL-C and the increase of insulin in young healthy females induced by a high-carbohydrate diet.
21680814 total lipase, ATGL and HSL activities were higher in visceral white adipose tissue of cancer patients compared with individuals without cancer and higher in cancer patients with cachexia compared with cancer patients without cachexia
21543206 Resveratrol increased adipose triglyceride lipase gene and protein expressions, an effect that was not observed for hormone-sensitive lipase in human SGBS adipocytes.
More...

AA Sequence

MEPGSKSVSRSDWQPEPHQRPITPLEPGPEKTPIAQPESKTLQGSNTQQKPASNQRPLTQQETPAQHDAE      1 - 70
SQKEPRAQQKSASQEEFLAPQKPAPQQSPYIQRVLLTQQEAASQQGPGLGKESITQQEPALRQRHVAQPG     71 - 140
PGPGEPPPAQQEAESTPAAQAKPGAKREPSAPTESTSQETPEQSDKQTTPVQGAKSKQGSLTELGFLTKL    141 - 210
QELSIQRSALEWKALSEWVTDSESESDVGSSSDTDSPATMGGMVAQGVKLGFKGKSGYKVMSGYSGTSPH    211 - 280
EKTSARNHRHYQDTASRLIHNMDLRTMTQSLVTLAEDNIAFFSSQGPGETAQRLSGVFAGVREQALGLEP    281 - 350
ALGRLLGVAHLFDLDPETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRTSHNLAELEAYLAALT    351 - 420
QLRALVYYAQRLLVTNRPGVLFFEGDEGLTADFLREYVTLHKGCFYGRCLGFQFTPAIRPFLQTISIGLV    421 - 490
SFGEHYKRNETGLSVAASSLFTSGRFAIDPELRGAEFERITQNLDVHFWKAFWNITEMEVLSSLANMASA    491 - 560
TVRVSRLLSLPPEAFEMPLTADPTLTVTISPPLAHTGPGPVLVRLISYDLREGQDSEELSSLIKSNGQRS    561 - 630
LELWPRPQQAPRSRSLIVHFHGGGFVAQTSRSHEPYLKSWAQELGAPIISIDYSLAPEAPFPRALEECFF    631 - 700
AYCWAIKHCALLGSTGERICLAGDSAGGNLCFTVALRAAAYGVRVPDGIMAAYPATMLQPAASPSRLLSL    701 - 770
MDPLLPLSVLSKCVSAYAGAKTEDHSNSDQKALGMMGLVRRDTALLLRDFRLGASSWLNSFLELSGRKSQ    771 - 840
KMSEPIAEPMRRSVSEAALAQPQGPLGTDSLKNLTLRDLSLRGNSETSSDTPEMSLSAETLSPSTPSDVN    841 - 910
FLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSML    911 - 980
KSLPPVHIVACALDPMLDDSVMLARRLRNLGQPVTLRVVEDLPHGFLTLAALCRETRQAAELCVERIRLV    981 - 1050
LTPPAGAGPSGETGAAGVDGGCGGRH                                               1051 - 1076
//

Text Mined References (97)

PMID Year Title
25819461 2015 Primary defects in lipolysis and insulin action in skeletal muscle cells from type 2 diabetic individuals.
25475467 2014 A novel LIPE nonsense mutation found using exome sequencing in siblings with late-onset familial partial lipodystrophy.
24848981 2014 Null mutation in hormone-sensitive lipase gene and risk of type 2 diabetes.
23688034 2013 Risk interaction of obesity, insulin resistance and hormone-sensitive lipase promoter polymorphisms (LIPE-60 C > G) in the development of fatty liver.
22553833 2012 Essential role of hormone-sensitive lipase (HSL) in the maintenance of lipid storage in Mycobacterium leprae-infected macrophages.
21933124 2012 Enzyme promiscuity in the hormone-sensitive lipase family of proteins.
21919688 2011 Genetic variation of hormone sensitive lipase and male infertility.
21826994 2011 [Effects of the LIPE C-60G polymorphism on changes of plasma lipids and glucose induced by a high-carbohydrate diet in healthy youth].
21680814 2011 Adipose triglyceride lipase contributes to cancer-associated cachexia.
21543206 2012 Resveratrol regulates lipolysis via adipose triglyceride lipase.
More...