Property Summary

NCBI Gene PubMed Count 668
Grant Count 967
R01 Count 686
Funding $66,766,697.08
PubMed Score 956.94
PubTator Score 1563.61

Knowledge Summary

Patent (30,498)

Expression

Synonym

Accession Q05397 B4E2N6 F5H4S4 J3QT16 Q14291 Q8IYN9 Q9UD85 FADK 1
Symbols FAK
FADK
FAK1
FRNK
PPP1R71
p125FAK
pp125FAK

Gene

PDB

1OW6   1OW7   1OW8   3B71   1K04   1K05   1MP8   2ETM   2IJM   3BZ3   3PXK   3S9O   4EBV   4EBW   4GU6   4GU9   4I4E   4I4F   4K8A   4K9Y   4KAB   4KAO   4NY0   4Q9S  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
727 screening 811 / 0 / 96078 Primary biochemical high-throughput screening assay for inhibitors of Focal Adhesion Kinase (FAK)
794 other 212 / 0 / 541 Confirmation biochemical assay for inhibitors of Focal Adhesion Kinase (FAK)
810 confirmatory 110 / 0 / 100 Dose-response biochemical assay for inhibitors of Focal Adhesion Kinase (FAK)
1802 summary 0 / 0 / 0 Summary of probe development efforts to identify inhibitors of Focal Adhesion Kinase (FAK)
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (519)

PMID Text
27009091 CEP-37440 decreased the cell proliferation of FC-IBC02, SUM190, and KPL4 by blocking the autophosphorylation kinase activity of FAK1 (Tyr 397).
26992741 Our findings suggest that the targets of FAK play a key role in metastasis
26975850 Increased focal adhesion kinase(FAK)activity.
26962872 Combining erlotinib with FAK inhibitor was also potent in vivo as evidenced by reduced tumor growth in the A549 mouse xenograft model.
26956728 Bit1 may be an important regulator in cell growth, apoptosis, migration and invasion of esophageal squamous cell carcinoma via targeting FAK-paxillin pathway.
26944318 In clinical samples of hepatocellular carcinom (HCC), miR-379-5p negatively correlated with FAK, which was up-regulated in HCC.
26923073 Collectively, our data demonstrate that DCMF induces cell migration and promotes wound healing through activation of Src/FAK, ERK, AKT, and p38 MAPK signaling.
26895766 Data suggest that, in colonic/prostatic neoplasm cells, increased expression of NDRG1 decreases activating phosphorylation of FAK and paxillin; silencing/inhibition of NDRG1 results in opposite effect and inhibits neoplasm cell migration/adhesion.
26892465 Data suggest that simultaneous targeting of mammalian target of rapamycin (mTOR)- and adhesion kinase (FAK)-related pathways might offer a strategy for treating acute lymphoblastic leukemia (ALL).
26833789 Modulation of FAK and Src adhesion signaling occurs independently of adhesion complex composition.
More...

AA Sequence

MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQK      1 - 70
IVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTED     71 - 140
KPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKS    141 - 210
LLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGI    211 - 280
SYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRL    281 - 350
VNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE    351 - 420
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVI    421 - 490
TENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCV    491 - 560
KLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNND    561 - 630
VIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQAT    631 - 700
VSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQ    701 - 770
TDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS    771 - 840
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLQPQEIS    841 - 910
PPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTH    911 - 980
REIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR    981 - 1050
PH                                                                       1051 - 1052
//

Text Mined References (702)

PMID Year Title
27009091 2016 The effects of CEP-37440, an inhibitor of focal adhesion kinase, in vitro and in vivo on inflammatory breast cancer cells.
26992741 2016 Ling Zhi-8 reduces lung cancer mobility and metastasis through disruption of focal adhesion and induction of MDM2-mediated Slug degradation.
26975850 2016 Loss of miR-203 regulates cell shape and matrix adhesion through ROBO1/Rac/FAK in response to stiffness.
26962872 2016 Focal Adhesion Kinase Inhibitors in Combination with Erlotinib Demonstrate Enhanced Anti-Tumor Activity in Non-Small Cell Lung Cancer.
26956728 2016 Bit1 knockdown contributes to growth suppression as well as the decreases of migration and invasion abilities in esophageal squamous cell carcinoma via suppressing FAK-paxillin pathway.
26944318 2016 MicroRNA-379-5p inhibits tumor invasion and metastasis by targeting FAK/AKT signaling in hepatocellular carcinoma.
26923073 2016 A synthetic isoflavone, DCMF, promotes human keratinocyte migration by activating Src/FAK signaling pathway.
26895766 2016 Targeting the Metastasis Suppressor, N-Myc Downstream Regulated Gene-1, with Novel Di-2-Pyridylketone Thiosemicarbazones: Suppression of Tumor Cell Migration and Cell-Collagen Adhesion by Inhibiting Focal Adhesion Kinase/Paxillin Signaling.
26892465 2016 Synergism between the mTOR inhibitor rapamycin and FAK down-regulation in the treatment of acute lymphoblastic leukemia.
26833789 2016 Modulation of FAK and Src adhesion signaling occurs independently of adhesion complex composition.
More...