Property Summary

NCBI Gene PubMed Count 107
PubMed Score 1065.42
PubTator Score 676.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.800 6.9e-06
astrocytic glioma -2.000 7.9e-03
Astrocytoma, Pilocytic -3.900 5.1e-12
atypical teratoid / rhabdoid tumor -3.100 1.5e-09
ependymoma -3.100 5.0e-04
glioblastoma -3.300 2.3e-11
group 3 medulloblastoma -4.600 4.5e-09
intraductal papillary-mucinous adenoma (... -1.300 3.2e-02
intraductal papillary-mucinous carcinoma... -1.300 3.8e-02
medulloblastoma, large-cell -2.900 1.6e-05
oligodendroglioma -2.100 2.3e-03
ovarian cancer 1.400 2.3e-12
primitive neuroectodermal tumor -1.900 1.7e-02

Protein-protein Interaction (1)

Gene RIF (104)

AA Sequence

MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGGSQPPRAAARK      1 - 70
AACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNE     71 - 140
LLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIA    141 - 210
PVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEH    211 - 280
SHFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAV    281 - 350
ADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ    351 - 420
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREG    421 - 490
YEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMV    491 - 560
ISNPAATHQDIDFLIEEIERLGQDL                                                 561 - 585
//

Text Mined References (108)

PMID Year Title