Property Summary

NCBI Gene PubMed Count 104
Grant Count 387
R01 Count 230
Funding $38,724,550.34
PubMed Score 1024.29
PubTator Score 676.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q05329 Q9UD87
Symbols GAD65

Gene

PANTHER Protein Class (2)

PDB

1ES0   2OKK  

Gene RIF (101)

PMID Text
26362234 UV exposed hydrogen peroxide produces hydroxyl radical that may cause protein damage (GAD-65) to the extent of generating neo-epitopes on the molecule, making it immunogenic.
25966064 we investigated the relationship between serum glutamic acid decarboxylase (GAD) autoantibody (Ab) levels and single nucleotide polymorphisms (SNPs) of the glutamic acid de-carboxylase 2 (GAD2) 5'-untranslated region
25816051 Plasma GAD65 qualifies as a marker for early beta-cell loss after intraportal transplantation.
25645784 Kaplan-Meier survival curves estimated a worst pancreas graft survival for patients with positive IA-2 antibodies versus those patients with negative auto-antibodies and GAD65+ auto-antibodies after simultaneous pancreas kidney transplantation.
25523979 GAD autoantibodies were associated with risk of developing type 1 diabetes.
25345799 Data suggest that women with gestational diabetes who develop autoantibodies against GAD2 (glutamate decarboxylase 2) exhibit higher blood glucose levels, insulin resistance, and impaired insulin secretion from beta cells in the postpartum period.
24993056 Cohort study shows that mean GAD65 mRNA levels in the prefrontal cortex area 9 are not altered in subjects with schizophrenia but are lower in subjects with schizoaffective disorder
24950944 Phosphate-activated glutaminase and GAD65/67 concentrations are compared in Alzheimer's disease cerebellum versus normal cerebellum controls
24874321 The decreased amount of GAD65 and GAD67 suggests the decreased synthesis of neurotransmitter and basic GABA pools that indicates insufficient functioning of the GABA system in the cerebellar cortex of Alzheimer's disease patients.
24661757 There is a marked gender dimorphism in GAD65 positivity, higher in obstructive sleep apnoea syndrome females vs. males.
More...

AA Sequence

MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGGSQPPRAAARK      1 - 70
AACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNE     71 - 140
LLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIA    141 - 210
PVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEH    211 - 280
SHFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAV    281 - 350
ADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ    351 - 420
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREG    421 - 490
YEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMV    491 - 560
ISNPAATHQDIDFLIEEIERLGQDL                                                 561 - 585
//

Text Mined References (105)

PMID Year Title
26362234 2015 Immuno-chemistry of hydroxyl radical modified GAD-65: A possible role in experimental and human diabetes mellitus.
25966064 2015 Relationship between serum GAD-Ab and the genetic polymorphisms of GAD2 and type 2 diabetes mellitus.
25816051 2015 Plasma GAD65, a Marker for Early ?-Cell Loss After Intraportal Islet Cell Transplantation in Diabetic Patients.
25645784 Tyrosine-phosphatase and glutamate-decarboxylase antibodies after simultaneous pancreas kidney transplantation: do they have an impact on pancreas graft survival?
25523979 2015 Autoantibody-defined risk for Type 1 diabetes mellitus in a general population of schoolchildren: results of the Karlsburg Type 1 Diabetes Risk Study after 18 years.
25416956 2014 A proteome-scale map of the human interactome network.
25345799 2015 Glutamic acid decarboxylase autoantibody-positivity post-partum is associated with impaired ?-cell function in women with gestational diabetes mellitus.
24993056 2015 Lower glutamic acid decarboxylase 65-kDa isoform messenger RNA and protein levels in the prefrontal cortex in schizoaffective disorder but not schizophrenia.
24950944 2014 Glutamate and GABA-metabolizing enzymes in post-mortem cerebellum in Alzheimer's disease: phosphate-activated glutaminase and glutamic acid decarboxylase.
24874321 2014 [A role of glutamate decarboxylase in Alzheimer's disease].
More...