Property Summary

NCBI Gene PubMed Count 30
Grant Count 209
R01 Count 86
Funding $29,195,434.29
PubMed Score 138.28
PubTator Score 19.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 4.268 0.002
Rhinitis 1.300 0.012
uncontrolled asthma 2.200 0.003
osteosarcoma -6.511 0.000
non-small cell lung cancer -1.804 0.000
interstitial cystitis 4.900 0.000
facioscapulohumeral dystrophy 3.600 0.000

Synonym

Accession Q05315 C5HZ13 C5HZ14 Q0VDE3 Gal-10
Symbols GAL10
Gal-10
LGALS10
LGALS10A
LPPL_HUMAN

Gene

CLC

PANTHER Protein Class (1)

PDB

1G86   1HDK   1LCL   1QKQ  

Gene RIF (12)

PMID Text
22880030 The results support the potential for galectin-10 to be used as a surrogate biomarker of eosinophilic airway inflammation.
21716316 CLC and IFNAR1 were identified to be overall differentially expressed between early- and late-onset CRC, and are important in the development of early-onset CRC.
20858065 DK-PGD-induced CLC/Gal-10 mRNA level can serve as a potential marker for monitoring pharmacodynamic effects of blood exposure to CRTH2 modulating agents
20237496 Observational study of gene-disease association. (HuGE Navigator)
19758173 Data show that galectin-10 expression was related to the histological grade and with the number of eosinophils in the lesion.
19650845 Genetic variation in Charcot-Leyden crystal protein was found to be associated with allergic rhinitis
19650845 Observational study of gene-disease association. (HuGE Navigator)
17502455 expressed in human T lymphocytes, galectin-10 is essential for the functional properties of CD25(+) Treg cells.
17166282 Downregulated in whole blood of infants hospitalised with respiratory syncytial virus (RSV), subtype B, bronchiolitis.
16015083 The five genes, and three of the encoded proteins, were shown differentially expressed between a group of keratoconus patients and a reference group using different techniques
More...

AA Sequence

MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYG      1 - 70
AWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYL     71 - 140
KR                                                                        141 - 142
//

Text Mined References (31)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
22880030 2012 Galectin-10, a potential biomarker of eosinophilic airway inflammation.
21716316 2011 CLC and IFNAR1 are differentially expressed and a global immunity score is distinct between early- and late-onset colorectal cancer.
20858065 2010 The mRNA level of Charcot-Leyden crystal protein/galectin-10 is a marker for CRTH2 activation in human whole blood in vitro.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19758173 2009 Galectin-10, eosinophils, and celiac disease.
19650845 2010 CLC- a novel susceptibility gene for allergic rhinitis?
19497882 2009 A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death.
17502455 2007 Human CD4+CD25+ regulatory T cells: proteome analysis identifies galectin-10 as a novel marker essential for their anergy and suppressive function.
More...