Property Summary

NCBI Gene PubMed Count 14
PubMed Score 27.64
PubTator Score 19.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.000 5.7e-03
astrocytic glioma -3.200 1.2e-03
Astrocytoma, Pilocytic -2.300 4.0e-05
atypical teratoid / rhabdoid tumor -1.300 7.8e-03
Down syndrome -1.500 3.9e-03
ependymoma -3.300 1.8e-03
glioblastoma -2.200 2.6e-08
group 3 medulloblastoma -2.700 6.5e-03
medulloblastoma, large-cell -4.500 8.6e-04
oligodendroglioma -3.000 1.2e-03
osteosarcoma 1.856 4.2e-05
pituitary cancer -1.500 5.9e-04
primitive neuroectodermal tumor -2.100 1.9e-03
psoriasis 3.800 8.8e-25

Gene RIF (6)

AA Sequence

MAVARGVGSPEPAPPQLYKWGGCGLGEPGSALERRGAAARGRCGRARAPRLPDSFPRGECPKPGARAPRS      1 - 70
VRCGEPLPPASPPPARPQAQRARPRAPHSRRRAMLHLSEFSEPDALLVKSTEGCCAEPSAELPRLPARDA     71 - 140
PAATGYPGAGDFLSWALNSCGASGDLADSCFLEGPAPTPPPGLSYSGSFFIQAVPEHPHDPEALFNLMSG    141 - 210
ILGLAPFPGPEAAASRSPLDAPFPAGSDALLPGPPDLYSPDLGAAPFPEAFWEASPCAGAPSQCLYEPQL    211 - 280
SPPDVKPGLRAPPASPALDAVSAFKGPYAPWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSIS    281 - 350
CPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLR    351 - 420
SAAAADFPKPLVADIPGSSGVAAPPVPPPPPTPFPQAKARRKGRRGGKCSTRCFCPRPHAKAFACPVESC    421 - 490
VRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHS    491 - 560
KVHLKQKARAEERLKGLGFYSLGLSFASL                                             561 - 589
//

Text Mined References (15)

PMID Year Title