Property Summary

NCBI Gene PubMed Count 12
Grant Count 10
R01 Count 6
Funding $327,595.3
PubMed Score 26.02
PubTator Score 19.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -3.200 0.001
ependymoma -5.000 0.000
oligodendroglioma -3.000 0.001
glioblastoma -5.300 0.000
osteosarcoma 1.856 0.000
group 4 medulloblastoma -5.300 0.000
atypical teratoid/rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -4.500 0.001
primitive neuroectodermal tumor -4.500 0.000
pediatric high grade glioma -5.200 0.000
pilocytic astrocytoma -5.000 0.000
pituitary cancer -1.500 0.001
Down syndrome -1.500 0.004
psoriasis 3.800 0.000

Gene RIF (5)

PMID Text
25613138 The gene expression of early growth response 4 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25411851 EGR4 directly transactivates specific variants (V3 and V4) of the PTHrP gene resulting in subsequent transactivation of the RANKL, IL-6 and IL-8 genes via paracrine action of the PTHrP protein.
22691714 data suggest a tendency of gender-specific association of EGR2 and EGR4 in schizophrenia.
20144677 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19828938 Data found multiple differences in gene expression between the high and low infertility risk groups, confirming the importance of an intact hypothalamo-pituitary testicular axis and EGR4 in fertility development

AA Sequence

MAVARGVGSPEPAPPQLYKWGGCGLGEPGSALERRGAAARGRCGRARAPRLPDSFPRGECPKPGARAPRS      1 - 70
VRCGEPLPPASPPPARPQAQRARPRAPHSRRRAMLHLSEFSEPDALLVKSTEGCCAEPSAELPRLPARDA     71 - 140
PAATGYPGAGDFLSWALNSCGASGDLADSCFLEGPAPTPPPGLSYSGSFFIQAVPEHPHDPEALFNLMSG    141 - 210
ILGLAPFPGPEAAASRSPLDAPFPAGSDALLPGPPDLYSPDLGAAPFPEAFWEASPCAGAPSQCLYEPQL    211 - 280
SPPDVKPGLRAPPASPALDAVSAFKGPYAPWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSIS    281 - 350
CPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLR    351 - 420
SAAAADFPKPLVADIPGSSGVAAPPVPPPPPTPFPQAKARRKGRRGGKCSTRCFCPRPHAKAFACPVESC    421 - 490
VRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHS    491 - 560
KVHLKQKARAEERLKGLGFYSLGLSFASL                                             561 - 589
//

Text Mined References (13)

PMID Year Title
25411851 2014 Early growth response 4 is involved in cell proliferation of small cell lung cancer through transcriptional activation of its downstream genes.
22691714 2012 Genetic and functional analyses of early growth response (EGR) family genes in schizophrenia.
20144677 2010 No association between EGR gene family polymorphisms and schizophrenia in the Chinese population.
19828938 2009 EGR4 is a master gene responsible for fertility in cryptorchidism.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12560487 2003 Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8504297 1993 Genomic organization, chromosomal localization and promoter function of the human zinc-finger gene pAT133.
More...