Property Summary

Ligand Count 1
NCBI Gene PubMed Count 80
PubMed Score 68.85
PubTator Score 66.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.027 2.8e-02
atypical teratoid / rhabdoid tumor 1.700 2.4e-04
Chronic Lymphocytic Leukemia 2.021 3.7e-05
ependymoma 1.100 2.2e-02
Gaucher disease type 1 -2.100 1.4e-02
glioblastoma 1.700 2.5e-03
group 4 medulloblastoma 1.600 1.1e-03
lung cancer -1.500 1.3e-02
medulloblastoma, large-cell 1.200 1.1e-02
oligodendroglioma 1.300 8.9e-03
osteosarcoma 1.567 2.7e-03
ovarian cancer -1.400 2.5e-04
pancreatic cancer 1.200 1.3e-04
pediatric high grade glioma 1.200 5.8e-05
primary pancreatic ductal adenocarcinoma 1.352 5.7e-03
primary Sjogren syndrome 1.200 3.1e-03
primitive neuroectodermal tumor 1.500 6.4e-05
psoriasis -1.200 3.3e-04
ulcerative colitis 1.100 1.9e-07

Protein-protein Interaction (4)

Gene RIF (25)

AA Sequence

MEQVEILRKFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVKKNRYKDILPF      1 - 70
DHSRVKLTLKTPSQDSDYINANFIKGVYGPKAYVATQGPLANTVIDFWRMIWEYNVVIIVMACREFEMGR     71 - 140
KKCERYWPLYGEDPITFAPFKISCEDEQARTDYFIRTLLLEFQNESRRLYQFHYVNWPDHDVPSSFDSIL    141 - 210
DMISLMRKYQEHEDVPICIHCSAGCGRTGAICAIDYTWNLLKAGKIPEEFNVFNLIQEMRTQRHSAVQTK    211 - 280
EQYELVHRAIAQLFEKQLQLYEIHGAQKIADGVNEINTENMVSSIEPEKQDSPPPKPPRTRSCLVEGDAK    281 - 350
EEILQPPEPHPVPPILTPSPPSAFPTVTTVWQDNDRYHPKPVLHMVSSEQHSADLNRNYSKSTELPGKNE    351 - 420
STIEQIDKKLERNLSFEIKKVPLQEGPKSFDGNTLLNRGHAIKIKSASPCIADKISKPQELSSDLNVGDT    421 - 490
SQNSCVDCSVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHGPENAIPIPDLSEGNSSDINY    491 - 560
QTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNPLHSDDSDSDERNSDGAVTQNKTNISTASAT    561 - 630
VSAATSTESISTRKVLPMSIARHNIAGTTHSGAEKDVDVSEDSPPPLPERTPESFVLASEHNTPVRSEWS    631 - 700
ELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPK    701 - 770
GPRDPPSEWT                                                                771 - 780
//

Text Mined References (93)

PMID Year Title