Property Summary

NCBI Gene PubMed Count 78
Grant Count 41
R01 Count 41
Funding $1,817,036.08
PubMed Score 65.86
PubTator Score 66.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Chronic Lymphocytic Leukemia 2.021 0.000
ependymoma 1.100 0.022
oligodendroglioma 1.300 0.009
psoriasis -1.200 0.000
glioblastoma 2.000 0.006
osteosarcoma 1.567 0.003
medulloblastoma 1.600 0.003
atypical teratoid / rhabdoid tumor 1.700 0.000
medulloblastoma, large-cell 1.200 0.011
primitive neuroectodermal tumor 1.500 0.000
adrenocortical carcinoma 1.027 0.028
primary pancreatic ductal adenocarcinoma 1.352 0.006
lung cancer -1.500 0.013
pancreatic cancer 1.400 0.003
pediatric high grade glioma 1.500 0.006
primary Sjogren syndrome 1.200 0.003
ulcerative colitis 1.100 0.000
ovarian cancer 1.500 0.001
Gaucher disease type 1 -2.100 0.014

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
488884 confirmatory 66 / 0 / 17 SAR Selectivity Analysis of small molecule inhibitors of PEST using pCAP in a fluorescence assay

Gene RIF (22)

PMID Text
26537073 PTPN12 expression decreases in human renal cell carcinoma
25868976 Study suggests that PTPN12 expression is a valuable prognostic biomarker for non-small cell lung cancer.
25663493 The decrease expression of PTPN12 might be important in conferring a more aggressive behavior in NPC. Thus, PTPN12 expression may be used as a novel independent prognostic biomarker for patients with NPC.
24475046 Decreased expression of PTPN12 correlates with tumor recurrence and poor survival of patients with hepatocellular carcinoma.
24285539 the activity of SHP-2, PTP-1beta, and PTP-PEST was enhanced by LKB1-expressing cells.
24284071 these data suggest that PTP-PEST affects epithelial cell motility by controlling the distribution and phosphorylation of p120 and its availability to control Rho GTPase activity.
23957009 MRNAs of PTPN12, MSH6, and ZEB1 orthologous genes from different animal species have binding sites for hsa-miR-1279 which consist of homologous oligonucleotides encoding similar human oligopeptides
23733313 Overexpression of PTPN12 inhibited proliferation and migration in OSCC cells.
23435421 The involvement of PTPN12 in the antioxidant response of breast cancer cells suggests that PTPN12 may represent a novel therapeutic target for this disease
23044628 PTPN12 is potentially a methylation-silenced TSG for breast cancer that may play an important role in breast carcinogenesis and could potentially serve as an independent prognostic factor for invasive breast cancer patients.
More...

AA Sequence

MEQVEILRKFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVKKNRYKDILPF      1 - 70
DHSRVKLTLKTPSQDSDYINANFIKGVYGPKAYVATQGPLANTVIDFWRMIWEYNVVIIVMACREFEMGR     71 - 140
KKCERYWPLYGEDPITFAPFKISCEDEQARTDYFIRTLLLEFQNESRRLYQFHYVNWPDHDVPSSFDSIL    141 - 210
DMISLMRKYQEHEDVPICIHCSAGCGRTGAICAIDYTWNLLKAGKIPEEFNVFNLIQEMRTQRHSAVQTK    211 - 280
EQYELVHRAIAQLFEKQLQLYEIHGAQKIADGVNEINTENMVSSIEPEKQDSPPPKPPRTRSCLVEGDAK    281 - 350
EEILQPPEPHPVPPILTPSPPSAFPTVTTVWQDNDRYHPKPVLHMVSSEQHSADLNRNYSKSTELPGKNE    351 - 420
STIEQIDKKLERNLSFEIKKVPLQEGPKSFDGNTLLNRGHAIKIKSASPCIADKISKPQELSSDLNVGDT    421 - 490
SQNSCVDCSVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHGPENAIPIPDLSEGNSSDINY    491 - 560
QTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNPLHSDDSDSDERNSDGAVTQNKTNISTASAT    561 - 630
VSAATSTESISTRKVLPMSIARHNIAGTTHSGAEKDVDVSEDSPPPLPERTPESFVLASEHNTPVRSEWS    631 - 700
ELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPK    701 - 770
GPRDPPSEWT                                                                771 - 780
//

Text Mined References (91)

PMID Year Title
27134172 2016 Crystal Structure and Substrate Specificity of PTPN12.
26537073 Protein tyrosine phosphatase nonreceptor type 12 suppresses the proliferation of renal cell carcinoma by inhibiting the activity of the PI3K/mTOR pathway.
25868976 2015 Tyrosine-protein phosphatase non-receptor type 12 expression is a good prognostic factor in resectable non-small cell lung cancer.
25663493 2015 The prognostic significance of tyrosine-protein phosphatase nonreceptor type 12 expression in nasopharyngeal carcinoma.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24475046 2014 Decreased expression of PTPN12 correlates with tumor recurrence and poor survival of patients with hepatocellular carcinoma.
24412244 2014 Charting the molecular links between driver and susceptibility genes in colorectal cancer.
24285539 2014 Liver kinase B1 expression promotes phosphatase activity and abrogation of receptor tyrosine kinase phosphorylation in human cancer cells.
24284071 2014 PTP-PEST targets a novel tyrosine site in p120 catenin to control epithelial cell motility and Rho GTPase activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...