Property Summary

NCBI Gene PubMed Count 126
Grant Count 148
R01 Count 115
Funding $19,405,799.87
PubMed Score 421.08
PubTator Score 111.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
interstitial lung disease 1.200 0.024
malignant mesothelioma 1.200 0.000
astrocytoma -2.500 0.000
ependymoma -4.400 0.000
psoriasis -2.200 0.000
glioblastoma -3.100 0.000
oligodendroglioma -2.700 0.000
sonic hedgehog group medulloblastoma -4.100 0.000
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -2.100 0.001
pediatric high grade glioma -3.200 0.000
pilocytic astrocytoma -2.500 0.000
lung carcinoma 1.600 0.000
Pick disease -2.100 0.012
ductal carcinoma in situ -1.100 0.023
invasive ductal carcinoma -1.400 0.013
facioscapulohumeral dystrophy 1.800 0.046

Synonym

Accession Q05193 A6NLM6 Q5SYX0 Q5SYX2 Q6P3T6 Q86VD2
Symbols DNM
EIEE31

Gene

PDB

1DYN   2DYN   2X2E   2X2F   3SNH   3ZYC   3ZYS   4UUD   4UUK   5D3Q  

Gene RIF (52)

PMID Text
27094744 Hypoxic down-regulation of constitutive endocytosis is HIF-independent, and involves caveolin-1-mediated inhibition of dynamin-dependent, membrane raft endocytosis.
26659814 Data indicate that stimulation of the dynamin GTPase activity by SH3 domains is determined by its middle domain.
26611353 study reports 2 patients with early onset epileptic encephalopathy possessing de novo DNM1 mutations; detected the novel mutation c.127G>A (p.Gly43Ser) in a patient with Lennox-Gastaut syndrome, and a recurrent mutation c.709C>T (p.Arg237Trp) in a patient with West syndrome
26479317 Data indicate the dynamics of a dynamin 1-catalysed GTP hydrolysis and tube-severing reaction in real time using fluorescence microscopy.
26165689 findings support a role for HTT on dynamin 1 function and ER homoeostasis. Proteolysis-induced alteration of this function may be relevant to disease.
26139537 CRISPR-Cas9n-mediated knockout and reconstitution studies establish that dynamin-1 is activated by Akt/GSK3beta signaling in H1299 non-small lung cancer cells.
26123023 molecular simulations corroborate the bimodal character of dynamin action and indicate radial and axial forces as dominant, although not independent, drivers of hemi-fission and fission membrane- transformations, respectively
25690657 Data suggest that by binding to both clathrin and F-actin, mammalian actin-binding protein 1 (mAbp1; HIP-55 or SH3P7) is specifically recruited at a late stage of clathrin-coated pits (CCPs) formation, which subsequently recruits dynamin to CCPs.
25450229 The rare variants in DNM1 were significantly associated with smoking status.
25262651 De novo mutations in synaptic transmission genes including DNM1 cause epileptic encephalopathies.
More...

AA Sequence

MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLV      1 - 70
LQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGM     71 - 140
TKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLM    141 - 210
DEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKV    211 - 280
LNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQ    281 - 350
IDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKI    351 - 420
REPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNH    421 - 490
EDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKE    491 - 560
KKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERV    561 - 630
GDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSE    631 - 700
LLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPA    701 - 770
GRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP    771 - 840
PGVPSRSGQASPSRPESPRPPFDL                                                  841 - 864
//

Text Mined References (134)

PMID Year Title
27094744 2016 Hypoxia regulates global membrane protein endocytosis through caveolin-1 in cancer cells.
26659814 2015 SH3 Domains Differentially Stimulate Distinct Dynamin I Assembly Modes and G Domain Activity.
26611353 2016 De novo DNM1 mutations in two cases of epileptic encephalopathy.
26479317 2015 A high-throughput platform for real-time analysis of membrane fission reactions reveals dynamin function.
26165689 2015 Huntingtin proteolysis releases non-polyQ fragments that cause toxicity through dynamin 1 dysregulation.
26139537 2015 Crosstalk between Akt/GSK3? signaling and dynamin-1 regulates clathrin-mediated endocytosis.
26123023 2015 A hemi-fission intermediate links two mechanistically distinct stages of membrane fission.
25690657 2015 Mammalian actin-binding protein 1/HIP-55 is essential for the scission of clathrin-coated pits by regulating dynamin-actin interaction.
25533962 2015 Large-scale discovery of novel genetic causes of developmental disorders.
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
More...