Property Summary

NCBI Gene PubMed Count 151
Grant Count 235
R01 Count 144
Funding $25,708,771.44
PubMed Score 420.78
PubTator Score 353.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.364 0.000
psoriasis -1.900 0.000
osteosarcoma -1.095 0.000
adult high grade glioma -1.300 0.000
group 4 medulloblastoma 1.100 0.000
primary Sjogren syndrome 1.100 0.000
ovarian cancer 2.200 0.000

Synonym

Accession Q05086 A8K8Z9 P78355 Q93066 Q9UEP4 Q9UEP5 Q9UEP6 Q9UEP7 Q9UEP8 Q9UEP9
Symbols AS
ANCR
E6-AP
HPVE6A
EPVE6AP

Gene

PANTHER Protein Class (2)

PDB

1C4Z   1D5F   1EQX   2KR1   4GIZ  

 GWAS Trait (1)

Gene RIF (107)

PMID Text
26789255 crystal structure of a ternary complex comprising full-length human papilloma virus type 16 (HPV-16) E6, the LxxLL motif of E6AP and the core domain of p53
26585570 The observation of Dup15q syndrome in individuals with maternally but not paternally inherited duplications of chromosome 15q11-q13, suggest that UBE3A drives the Angelman syndrome phenotype in this disorder. (Review)
26318036 our results indicate that CSN6 is a positive regulator of E6AP and is important for cervical cancer development.
26261538 Stable over-expression of E6-AP increases the proliferation and invasion of prostate tumor cells.
26255772 Study describes an upstream regulatory mechanism for UBE3A and provides a comprehensive understanding of how missense mutations linked to Angelman syndrome and autism affect UBE3A protein function.
26224081 The miR-375-UBE3A axis is important in modulating radiosensitivity of HR-HPV (+) cervical cancer.
26216987 The activity of E6AP is controlled by noncovalent interactions with ubiquitin and allosteric activators such as the HPV E6 oncoprotein.
26166566 Impairments in both synaptic plasticity and fear conditioning memory in UBE3A-deficient mice are significantly ameliorated by blocking SK2. These results elucidate a mechanism by which UBE3A directly influences cognitive function.
26161728 E6-AP Lys(847) is required for the formation of Lys(48)-linked polyubiquitin chains.
25816213 UBE3A may regulate the expression of annexin A2, resulting in promotion of proliferation and invasion and suppression of apoptosis in breast cancer cells.
More...

AA Sequence

MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAI      1 - 70
KALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELC     71 - 140
REREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEAS    141 - 210
SSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRD    211 - 280
PNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYK    281 - 350
VISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNK    351 - 420
KGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTCPFILNAVTKN    421 - 490
LGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFE    491 - 560
GEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILD    561 - 630
VHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENG    631 - 700
DKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQAL    701 - 770
EETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTS    771 - 840
HTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML                                       841 - 875
//

Text Mined References (159)

PMID Year Title
26789255 2016 Structure of the E6/E6AP/p53 complex required for HPV-mediated degradation of p53.
26585570 2015 Epigenetic regulation of UBE3A and roles in human neurodevelopmental disorders.
26318036 2015 COP9 signalosome subunit 6 (CSN6) regulates E6AP/UBE3A in cervical cancer.
26261538 2015 Impact of E6-associated protein on the proliferation and invasion of prostate cancer cells in bone metastasis.
26255772 2015 An Autism-Linked Mutation Disables Phosphorylation Control of UBE3A.
26224081 2015 miR-375 Modulates Radiosensitivity of HR-HPV-Positive Cervical Cancer Cells by Targeting UBE3A through the p53 Pathway.
26216987 2015 Role of ubiquitin and the HPV E6 oncoprotein in E6AP-mediated ubiquitination.
26166566 2015 UBE3A Regulates Synaptic Plasticity and Learning and Memory by Controlling SK2 Channel Endocytosis.
26161728 2015 Catalytically Important Residues of E6AP Ubiquitin Ligase Identified Using Acid-Cleavable Photo-Cross-Linkers.
25816213 2015 Knockdown of ubiquitin protein ligase E3A affects proliferation and invasion, and induces apoptosis of breast cancer cells through regulation of annexin A2.
More...