Property Summary

NCBI Gene PubMed Count 38
Grant Count 7
R01 Count 7
Funding $709,257.85
PubMed Score 69.01
PubTator Score 130.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (9)

PMID Text
24358315 C-terminal domain of ICA69 interacts with PICK1 and acts on trafficking of PICK1-PKCalpha complex and cerebellar plasticity.
23836780 Novel association was found between intraocular pressure and a common variant at 7p21 near to GLCCI1 and ICA1.
23333304 HIV-1 Vif downregulates the expression of islet cell autoantigen 1 (ICA1, 69kDa) in Vif-expression T cells
22447927 polymorphisms within the NOD Ica1 core promoter may determine AIRE-mediated down-regulation of ICA69 expression in medullary thymic epithelial cells.
20962850 Observational study of gene-disease association. (HuGE Navigator)
20526340 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187231 ICA69 as a novel Rab2 effector and its role in regulating the early transport of insulin secretory granule proteins
12409289 The exon A promoter exhibits greater activity in islet cells, whereas the exon B promoter more efficiently activates transcription in neuronal cells.

AA Sequence

MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTC      1 - 70
LDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQE     71 - 140
VETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKM    141 - 210
DVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEK    211 - 280
EEKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKS    281 - 350
EEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQ    351 - 420
TGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA           421 - 483
//

Text Mined References (41)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24358315 2013 C-terminal domain of ICA69 interacts with PICK1 and acts on trafficking of PICK1-PKC? complex and cerebellar plasticity.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23836780 2013 Genome-wide association study of intraocular pressure identifies the GLCCI1/ICA1 region as a glaucoma susceptibility locus.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22447927 2012 Sequence variation in promoter of Ica1 gene, which encodes protein implicated in type 1 diabetes, causes transcription factor autoimmune regulator (AIRE) to increase its binding and down-regulate expression.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20526340 2010 Common variants in FOXP1 are associated with generalized vitiligo.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...