Property Summary

NCBI Gene PubMed Count 38
PubMed Score 69.01
PubTator Score 130.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Obesity 616
Disease Target Count P-value
lung carcinoma 2844 2.90328434856542E-41
posterior fossa group A ependymoma 1511 8.23928809455195E-13
medulloblastoma 1524 2.64883471978893E-11
atypical teratoid / rhabdoid tumor 4369 1.29683834711637E-9
lung adenocarcinoma 2714 1.22671861188389E-7
glioblastoma 5572 3.68842332185354E-7
pediatric high grade glioma 2712 1.34029647585582E-6
pilocytic astrocytoma 3086 2.06331103542867E-5
malignant mesothelioma 3163 2.29315418986954E-5
interstitial cystitis 2299 4.72892457916835E-5
osteosarcoma 7933 1.33644875231491E-4
primitive neuroectodermal tumor 3031 1.36715034175879E-4
medulloblastoma, large-cell 6234 4.22541597848162E-4
lung cancer 4473 6.60010956839309E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00303425445949109
colon cancer 1475 0.00758445142355881
oligodendroglioma 2849 0.00896119429384769
esophageal adenocarcinoma 737 0.0182449562946412
invasive ductal carcinoma 2950 0.0491653573789765
Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 0.0 2.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.599 1.8

Expression

  Differential Expression (19)

Synonym

Accession Q05084 A8K7U1 B3FTQ2 P78506 Q13824 Q96HG3
Symbols ICA69
ICAp69

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (9)

PMID Text
24358315 C-terminal domain of ICA69 interacts with PICK1 and acts on trafficking of PICK1-PKCalpha complex and cerebellar plasticity.
23836780 Novel association was found between intraocular pressure and a common variant at 7p21 near to GLCCI1 and ICA1.
23333304 HIV-1 Vif downregulates the expression of islet cell autoantigen 1 (ICA1, 69kDa) in Vif-expression T cells
22447927 polymorphisms within the NOD Ica1 core promoter may determine AIRE-mediated down-regulation of ICA69 expression in medullary thymic epithelial cells.
20962850 Observational study of gene-disease association. (HuGE Navigator)
20526340 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187231 ICA69 as a novel Rab2 effector and its role in regulating the early transport of insulin secretory granule proteins
12409289 The exon A promoter exhibits greater activity in islet cells, whereas the exon B promoter more efficiently activates transcription in neuronal cells.

AA Sequence

MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTC      1 - 70
LDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQE     71 - 140
VETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKM    141 - 210
DVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEK    211 - 280
EEKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKS    281 - 350
EEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQ    351 - 420
TGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA           421 - 483
//

Text Mined References (41)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24358315 2013 C-terminal domain of ICA69 interacts with PICK1 and acts on trafficking of PICK1-PKC? complex and cerebellar plasticity.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23836780 2013 Genome-wide association study of intraocular pressure identifies the GLCCI1/ICA1 region as a glaucoma susceptibility locus.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22447927 2012 Sequence variation in promoter of Ica1 gene, which encodes protein implicated in type 1 diabetes, causes transcription factor autoimmune regulator (AIRE) to increase its binding and down-regulate expression.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20526340 2010 Common variants in FOXP1 are associated with generalized vitiligo.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...