Property Summary

NCBI Gene PubMed Count 38
PubMed Score 72.43
PubTator Score 130.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.300 3.8e-04
Astrocytoma, Pilocytic -1.100 2.1e-05
atypical teratoid / rhabdoid tumor -2.200 1.3e-09
colon cancer 1.400 7.6e-03
ependymoma -1.100 9.9e-03
esophageal adenocarcinoma 1.100 1.8e-02
glioblastoma -1.300 2.3e-08
group 3 medulloblastoma -1.800 4.2e-04
interstitial cystitis -1.400 4.6e-04
intraductal papillary-mucinous neoplasm ... 1.100 3.0e-03
invasive ductal carcinoma 1.100 4.9e-02
lung adenocarcinoma 1.300 1.2e-07
lung cancer 1.400 3.5e-03
lung carcinoma 2.100 2.9e-41
malignant mesothelioma 1.100 2.3e-05
medulloblastoma, large-cell -1.800 4.2e-04
oligodendroglioma -1.100 9.0e-03
osteosarcoma -1.506 1.3e-04
primitive neuroectodermal tumor -1.700 1.4e-04

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTC      1 - 70
LDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQE     71 - 140
VETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKM    141 - 210
DVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEK    211 - 280
EEKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFKTEDGKSILSALDKGSTHTACSGPIDELLDMKS    281 - 350
EEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQ    351 - 420
TGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA           421 - 483
//

Text Mined References (41)

PMID Year Title