Property Summary

NCBI Gene PubMed Count 168
PubMed Score 3115.19
PubTator Score 1174.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Azoospermia 110
Cryptorchidism 296
Gynecomastia 64
45,X/46,XY Mixed Gonadal Dysgenesis 1
46, XX Testicular Disorders of Sex Development 3
46,Xy Gonadal Dysgenesis, Complete, Sry-Related 1
Abnormal scrotal rugation 2
Abnormal sex determination 11
Abnormality of female external genitalia 8
Abnormality of male internal genitalia 4
Abnormality of the labia 9
Abnormality of the scrotum 9
Absence of secondary sex characteristics 22
Ambiguous Genitalia 24
Ambiguous genitalia due to virilization 9
Ambiguous genitalia, female 9
Ambiguous genitalia, male 9
Bifid scrotum 16
Bilateral Cryptorchidism 3
Congenital hypoplasia of penis 176
Decreased fertility 33
Decreased fertility in females 20
Decreased testosterone in males 28
Delayed Puberty 97
Elevated follicle stimulating hormone 15
Elevated gonadotropins 15
Elevated luteinizing hormone 14
Female external genitalia in males 13
Gonadal Dysgenesis 28
Gonadal Dysgenesis, Mixed 19
Hypertrophy of clitoris 40
Hypogonadism, Isolated Hypogonadotropic 71
Hypogonadotropic hypogonadism 89
Hypoplasia of scrotum 24
Hypoplasia of vagina 14
Hypospadias, penoscrotal 2
Low serum estradiol levels 22
Male Pseudohermaphroditism 19
Male infertility 206
Muscle hypertrophy of the lower extremities 2
Osteoporosis 363
Ovotesticular Disorders of Sex Development 2
Penile hypospadias 106
Polycystic ovary syndrome 360
Primary hypogonadism 37
Primary physiologic amenorrhea 55
Pure gonadal dysgenesis 19
Rudimentary vagina 14
Sclerocystic Ovaries 17
Sex reversal 10
Short stature 531
Small testicle 75
Sparse axillary hair 28
Sparse pubic hair 31
Streak ovary 15
Swyer Syndrome 8
Tall stature 34
Testicular dysgenesis 9
Testicular hypogonadism 21
Testicular regression syndrome 9
True Hermaphroditism (disorder) 4
Unilateral Cryptorchidism 2
Urogenital sinus anomaly 15
Uterine Anomalies 5
XX males 3
Disease Target Count P-value
medulloblastoma, large-cell 6241 1.1e-03

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.100 1.1e-03

Gene RIF (77)

AA Sequence

MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVW      1 - 70
SRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPK     71 - 140
NCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL          141 - 204
//

Text Mined References (166)

PMID Year Title