Property Summary

NCBI Gene PubMed Count 17
PubMed Score 44.34
PubTator Score 22.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.806 8.7e-07
adult high grade glioma 1.600 5.1e-04
Astrocytoma, Pilocytic 1.900 2.5e-08
atypical teratoid / rhabdoid tumor 1.700 4.4e-03
ependymoma 2.500 2.1e-19
glioblastoma 2.000 3.5e-07
group 3 medulloblastoma 1.400 1.8e-03
medulloblastoma, large-cell 1.500 2.4e-03
Multiple myeloma 1.384 5.8e-04
non diabetic and post-ischemic heart fai... -1.200 4.5e-03
ovarian cancer -1.700 3.9e-05
pancreatic ductal adenocarcinoma liver m... 1.414 1.2e-02

Gene RIF (6)

AA Sequence

MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCD      1 - 70
LHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRH     71 - 140
TAAPTDPADGPV                                                              141 - 152
//

Text Mined References (20)

PMID Year Title