Property Summary

NCBI Gene PubMed Count 17
Grant Count 25
R01 Count 15
Funding $10,763,404.14
PubMed Score 42.64
PubTator Score 22.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26287415 PLP2 specifically binds to phosphatidylinositol 3 kinase to activate the protein kinase B pathway to enhance cell proliferation, adhesion, and invasion in melanoma cells.
25735976 miR-664 negatively regulates PLP2 and promotes proliferation and invasion of T-ALL cell lines. Thus, miR-664 may represent a potential therapeutic target for T-ALL intervention.
24604726 PLP2 and RAB5C are binding partners of TPD52.
24278019 This work ascribes a critical function to PLP2 for viral ligase activity and underlines the power of non-lethal haploid genetic screens in human cells to identify the genes involved in pathogen manipulation of the host immune system.
17416750 PLP2 is expressed abundantly in the pyramidal cells of hippocampus and granular cells of the cerebellum in the brains of a cohort of males with probable X-linked mental retardation.
15474493 PLP2/A4 has a role in the chemotactic processes via CCR1

AA Sequence

MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCD      1 - 70
LHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRH     71 - 140
TAAPTDPADGPV                                                              141 - 152
//

Text Mined References (20)

PMID Year Title
26287415 2015 Loss of MiR-664 Expression Enhances Cutaneous Malignant Melanoma Proliferation by Upregulating PLP2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25735976 2015 miR-664 negatively regulates PLP2 and promotes cell proliferation and invasion in T-cell acute lymphoblastic leukaemia.
25416956 2014 A proteome-scale map of the human interactome network.
24604726 2014 Identification of PLP2 and RAB5C as novel TPD52 binding partners through yeast two-hybrid screening.
24278019 2013 Haploid genetic screens identify an essential role for PLP2 in the downregulation of novel plasma membrane targets by viral E3 ubiquitin ligases.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
17416750 2007 X chromosome cDNA microarray screening identifies a functional PLP2 promoter polymorphism enriched in patients with X-linked mental retardation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...