Property Summary

Ligand Count 1
NCBI Gene PubMed Count 112
PubMed Score 41.97
PubTator Score 34.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.129 2.8e-05
adult high grade glioma -1.700 4.2e-04
astrocytic glioma -2.500 3.9e-03
Astrocytoma, Pilocytic -1.600 1.1e-06
atypical teratoid / rhabdoid tumor -3.000 2.3e-10
ependymoma -2.900 4.2e-03
glioblastoma -1.500 7.9e-07
group 4 medulloblastoma -1.300 2.8e-03
lung adenocarcinoma 1.297 1.7e-06
medulloblastoma, large-cell -2.600 1.0e-06
oligodendroglioma -2.100 2.6e-02
Pick disease -1.500 9.8e-03
primary pancreatic ductal adenocarcinoma 1.057 2.4e-02
primitive neuroectodermal tumor -1.600 2.5e-04
subependymal giant cell astrocytoma -2.152 3.6e-02

 GWAS Trait (1)

Gene RIF (28)

AA Sequence

MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT      1 - 70
MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG     71 - 140
EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT    141 - 210
LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN                                      211 - 246
//

Text Mined References (119)

PMID Year Title