Property Summary

NCBI Gene PubMed Count 107
PubMed Score 41.76
PubTator Score 34.09

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.34357240562673E-10
medulloblastoma 1524 6.45557897296504E-10
glioblastoma 5572 3.0342349597994E-7
medulloblastoma, large-cell 6234 1.00936760444107E-6
pilocytic astrocytoma 3086 1.37082410934628E-6
lung adenocarcinoma 2714 1.66751119254275E-6
acute quadriplegic myopathy 1157 2.82344186073113E-5
primitive neuroectodermal tumor 3031 2.47380038346127E-4
adult high grade glioma 2148 4.23373283633991E-4
astrocytic glioma 2241 0.0038603754172054
ependymoma 2514 0.0041897734708132
Pick disease 1893 0.00978378875821312
primary pancreatic ductal adenocarcinoma 1271 0.0244536763512496
oligodendroglioma 2849 0.0259831767216395
subependymal giant cell astrocytoma 2287 0.0355908022975843
Disease Target Count Z-score Confidence
Schizophrenia 503 3.205 1.6


  Differential Expression (15)


Accession Q04917
Symbols YWHA1


PANTHER Protein Class (1)


2C63   2C74  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (26)

24751211 Extracellular 14-3-3eta activates key signalling cascades and induces factors associated with the pathogenesis of rheumatoid arthritis
24507884 This study identified YWHAH significantly associated loci with a biologically plausible role in schizophrenia.
22562251 14-3-3eta may be required for mitotic progression and may be considered as a novel anti-cancer strategy in combination with microtubule inhibitors.
21739144 This is the first genetic association study of YWHAH with sporadic Creutzfeldt-Jakob disease populations.
21432775 relocation of p33ING1b from the nucleus to the cytoplasm, where the protein is tethered by 14-3-3eta, participates in tumorigenesis and progression in HNSCC
21416292 Data indicate that gene analysis revealed an up-regulation of all four 14-3-3 isoforms beta, eta, gamma, and sigma.
21318276 HIV-1 Vpr inhibits insulin-induced association of 14-3-3 and Foxo3a in HeLa cells
20388496 The 14-3-3 eta, beta, gamma and sigma isoforms were negatively expressed in meningioma
20012529 HIV-1 Vpr inhibits insulin-induced association of 14-3-3 and Foxo3a in HeLa cells
19558434 14-3-3beta, 14-3-3gamma, 14-3-3epsilon, 14-3-3eta and 14-3-3theta isoforms interact with the GPIb-IX complex in platelets

AA Sequence

LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN                                      211 - 246

Text Mined References (115)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24895406 2014 The chaperone-like protein 14-3-3? interacts with human ?-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing ?-synuclein cellular toxicity.
24751211 2014 14-3-3? is a novel mediator associated with the pathogenesis of rheumatoid arthritis and joint damage.
24507884 2014 Combined analysis of exon splicing and genome wide polymorphism data predict schizophrenia risk loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23622247 2013 14-3-3 proteins interact with a hybrid prenyl-phosphorylation motif to inhibit G proteins.