Property Summary

NCBI Gene PubMed Count 124
Grant Count 48
R01 Count 38
Funding $5,465,227.35
PubMed Score 318.49
PubTator Score 348.33

Knowledge Summary

Patent (42,933)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (110)

PMID Text
26951679 the MST1R variant c.G917A:p.R306H is highly associated with nasopharyngeal carcinoma (odds ratio of 9.0).
26775595 Study identified four novel uniquely spliced RON transcripts in small cell lung carcinoma (SCLC) and Non-SCLC cell lines.
26772202 Results show that under hypoxia, nuclear RON activates non-homologous end joining DNA repair by interacting with Ku70 and DNA-PKcs and confers chemoresistance.
26721331 Aberrant glycosylation of the RON receptor was shown as an alternative mechanism of oncogenic activation.
26189249 RON expression in endometrial adenocarcinoma was significantly higher than that in normal endometrial tissues.
26152593 Activation of RON as an alternate mechanism in the development of CRPC.
25997828 Data demonstrated upregulated RON isoform expression and significant changes in splicing factor expression in primary ovarian cancer suggesting a regulatory interplay of splicing factor and RON alternative splicing pattern in ovarian cancer.
25874493 the prognostic significance of MET is limited in early stage disease. MET+/RON+ patients had higher overall recurrence rates than those with the other expression patterns
25512530 approach identified 18 kinase and kinase-related genes whose overexpression can substitute for EGFR in EGFR-dependent PC9 cells, and these genes include seven of nine Src family kinase genes, FGFR1, FGFR2, ITK, NTRK1, NTRK2, MOS, MST1R, and RAF1.
25220236 SRSF2 promotes exon 11 inclusion of Ron proto-oncogene through targeting exon 11.
More...

AA Sequence

MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAV      1 - 70
FVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQ     71 - 140
GRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAAS    141 - 210
FSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRL    211 - 280
ARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVF    281 - 350
VTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT    351 - 420
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFS    421 - 490
LGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPG    491 - 560
SWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSGLVPEGTHQVTVGQSPCRPLPKDSSKLRPVP    561 - 630
RKDFVEEFECELEPLGTQAVGPTNVSLTVTNMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGT    631 - 700
CLTLEGQSLSVGTSRAVLVNGTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDP    701 - 770
VVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG    771 - 840
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTVGGESCQHEFR    841 - 910
GDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLGILLPLLLLVAALATALVFSY    911 - 980
WWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSGLALPAIDGLDSTTCVHGASFSDSEDESCVP    981 - 1050
LLRKESIQLRDLDSALLAEVKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRIT   1051 - 1120
EMQQVEAFLREGLLMRGLNHPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGL   1121 - 1190
QVARSMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ   1191 - 1260
TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVMQQCWEADPAV   1261 - 1330
RPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQFSPMPGNVRRPRPLSEPPRPT   1331 - 1400
//

Text Mined References (135)

PMID Year Title
26951679 2016 Whole-exome sequencing identifies MST1R as a genetic susceptibility gene in nasopharyngeal carcinoma.
26775595 2016 Novel splicing variants of recepteur d'origine nantais (RON) tyrosine kinase involving exons 15-19 in lung cancer.
26772202 2016 RON Nuclear Translocation under Hypoxia Potentiates Chemoresistance to DNA Double-Strand Break-Inducing Anticancer Drugs.
26721331 2016 Glycomic analysis of gastric carcinoma cells discloses glycans as modulators of RON receptor tyrosine kinase activation in cancer.
26189249 2015 c-Met and RON expression levels in endometrial adenocarcinoma tissue and their relationship with prognosis.
26152593 2015 Recepteur d'origine nantais (RON), more than a kinase: Role in castrate-resistant prostate cancer.
25997828 2015 RON alternative splicing regulation in primary ovarian cancer.
25874493 2015 MET is a predictive factor for late recurrence but not for overall survival of early stage hepatocellular carcinoma.
25512530 2014 Genetic modifiers of EGFR dependence in non-small cell lung cancer.
25220236 2014 SRSF2 promotes splicing and transcription of exon 11 included isoform in Ron proto-oncogene.
More...