Property Summary

NCBI Gene PubMed Count 31
Grant Count 7
R01 Count 5
Funding $918,751
PubMed Score 32.49
PubTator Score 29.32

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q04900 B4DQ85 E1P5E7 E1P5E8 E1P5E9 O95413 Q5JSU6 Q9BPV0 Q9NR26 MUC-24
Symbols DFNA66
MGC-24
MUC-24
MGC-24v
endolyn

Gene

PANTHER Protein Class (1)

Gene RIF (15)

PMID Text
26197441 This paper identified a new Deafness, Autosomal Dominant locus located on chromosome 6q15-21 and implicated CD164 as a novel gene for hearing impairment.
25980612 Infectious wild type HIV-1 production is restricted by 293T cells over-expressing CD164
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD164
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD164
24756834 miR-219 inhibits the proliferation, migration and invasion of medulloblastoma cells by targeting CD164.
24094005 Increased expression of CD164 is involved in ovarian cancer progression via the SDF-1alpha/CXCR4 axis.
22409183 CD164 is highly expressed in the colon cancer sites, and it promotes HCT116 colon cancer cell proliferation and metastasis both in vitro and in vivo
21999799 C-jun and HIF-1alpha bound to the CD164 promoter region and activated the CD164 expression.
20872290 Conclude that assessment of allergen-induced basophil CD164 upregulation is a very useful method for in vitro determination of allergy to grass pollens.
18854154 Infectious wild type HIV-1 production is restricted by 293T cells over-expressing CD164
More...

AA Sequence

MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSC      1 - 70
FNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVT     71 - 140
TSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL                 141 - 197
//

Text Mined References (33)

PMID Year Title
27517145 2016 CD164 promotes lung tumor-initiating cells with stem cell activity and determines tumor growth and drug resistance via Akt/mTOR signaling.
27376157 2016 MicroRNA-124 suppresses tumor cell proliferation and invasion by targeting CD164 signaling pathway in non-small cell lung cancer.
26524186 2016 Expression of CD164 on Malignant T cells in Sézary Syndrome.
26197441 2015 A Novel Locus Harbouring a Functional CD164 Nonsense Mutation Identified in a Large Danish Family with Nonsyndromic Hearing Impairment.
25416956 2014 A proteome-scale map of the human interactome network.
24756834 2014 miR-219 inhibits the proliferation, migration and invasion of medulloblastoma cells by targeting CD164.
24094005 2013 CD164 regulates the tumorigenesis of ovarian surface epithelial cells through the SDF-1?/CXCR4 axis.
23792457 2014 CD164 and FCRL3 are highly expressed on CD4+CD26- T cells in Sézary syndrome patients.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
22409183 2012 Inhibiting CD164 expression in colon cancer cell line HCT116 leads to reduced cancer cell proliferation, mobility, and metastasis in vitro and in vivo.
More...