Property Summary

NCBI Gene PubMed Count 32
PubMed Score 34.62
PubTator Score 29.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.204 6.8e-05
aldosterone-producing adenoma -1.269 4.6e-02
Astrocytoma, Pilocytic 1.100 4.0e-03
atypical teratoid / rhabdoid tumor 2.000 6.5e-05
Breast cancer 1.200 1.3e-05
dermatomyositis 1.500 8.2e-04
Down syndrome 1.500 2.1e-04
ependymoma 1.900 4.5e-02
glioblastoma 1.200 4.2e-04
hereditary spastic paraplegia -1.417 1.0e-02
intraductal papillary-mucinous adenoma (... 1.100 1.4e-02
intraductal papillary-mucinous carcinoma... 1.100 3.2e-02
intraductal papillary-mucinous neoplasm ... 1.200 4.3e-02
juvenile dermatomyositis 1.197 6.1e-11
lung adenocarcinoma 1.376 1.6e-05
medulloblastoma 1.100 8.9e-03
Multiple myeloma 1.572 1.1e-03
osteosarcoma 1.037 4.6e-02
ovarian cancer -1.500 1.4e-08
pediatric high grade glioma 1.700 8.5e-05
progressive supranuclear palsy -1.200 2.6e-02

Gene RIF (17)

AA Sequence

MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSC      1 - 70
FNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVT     71 - 140
TSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL                 141 - 197
//

Text Mined References (34)

PMID Year Title