Property Summary

NCBI Gene PubMed Count 31
PubMed Score 32.49
PubTator Score 29.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Spontaneous abortion 108
Disease Target Count P-value
juvenile dermatomyositis 1189 6.14568990433707E-11
lung adenocarcinoma 2714 8.78865299308102E-9
osteosarcoma 7933 1.22002605960738E-7
ovarian cancer 8492 1.06591144994276E-5
Breast cancer 3099 1.27060817611689E-5
glioblastoma 5572 4.38042784331934E-5
atypical teratoid / rhabdoid tumor 4369 6.52336943488564E-5
pediatric high grade glioma 2712 8.49227492215191E-5
Down syndrome 548 2.06754500229234E-4
acute quadriplegic myopathy 1157 5.94858258644561E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.58011621913403E-4
dermatomyositis 967 8.19437437160496E-4
Multiple myeloma 1328 0.00109667382571441
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00177438120750314
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00282653900686018
pilocytic astrocytoma 3086 0.00321465480389238
medulloblastoma 1524 0.00890985661084232
hereditary spastic paraplegia 313 0.0102814573179101
progressive supranuclear palsy 674 0.0259636957610584
ependymoma 2514 0.0447569651203056
aldosterone-producing adenoma 664 0.0458139891813478
Disease Target Count Z-score Confidence
Nonsyndromic deafness 121 0.0 4.0
Disease Target Count Z-score Confidence
Pollen allergy 6 3.855 1.9
Bruton-type agammaglobulinemia 2 3.3 1.7

Expression

Synonym

Accession Q04900 B4DQ85 E1P5E7 E1P5E8 E1P5E9 O95413 Q5JSU6 Q9BPV0 Q9NR26 MUC-24
Symbols DFNA66
MGC-24
MUC-24
MGC-24v
endolyn

Gene

PANTHER Protein Class (1)

  Ortholog (9)

 CSPA Cell Line (4)

Gene RIF (14)

PMID Text
26197441 This paper identified a new Deafness, Autosomal Dominant locus located on chromosome 6q15-21 and implicated CD164 as a novel gene for hearing impairment.
25980612 Infectious wild type HIV-1 production is restricted by 293T cells over-expressing CD164
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD164
24756834 miR-219 inhibits the proliferation, migration and invasion of medulloblastoma cells by targeting CD164.
24094005 Increased expression of CD164 is involved in ovarian cancer progression via the SDF-1alpha/CXCR4 axis.
22409183 CD164 is highly expressed in the colon cancer sites, and it promotes HCT116 colon cancer cell proliferation and metastasis both in vitro and in vivo
21999799 C-jun and HIF-1alpha bound to the CD164 promoter region and activated the CD164 expression.
20872290 Conclude that assessment of allergen-induced basophil CD164 upregulation is a very useful method for in vitro determination of allergy to grass pollens.
18854154 Infectious wild type HIV-1 production is restricted by 293T cells over-expressing CD164
17077324 sialomucin endolyn (CD164), an adhesion receptor that regulates the adhesion of CD34+ cells to bone marrow stroma and the recruitment of CD34+CD38(lo/-) cells into cycle, associates with CXCR4
More...

AA Sequence

MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSC      1 - 70
FNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVT     71 - 140
TSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL                 141 - 197
//

Text Mined References (33)

PMID Year Title
27517145 2016 CD164 promotes lung tumor-initiating cells with stem cell activity and determines tumor growth and drug resistance via Akt/mTOR signaling.
27376157 2016 MicroRNA-124 suppresses tumor cell proliferation and invasion by targeting CD164 signaling pathway in non-small cell lung cancer.
26524186 2016 Expression of CD164 on Malignant T cells in Sézary Syndrome.
26197441 2015 A Novel Locus Harbouring a Functional CD164 Nonsense Mutation Identified in a Large Danish Family with Nonsyndromic Hearing Impairment.
25416956 2014 A proteome-scale map of the human interactome network.
24756834 2014 miR-219 inhibits the proliferation, migration and invasion of medulloblastoma cells by targeting CD164.
24094005 2013 CD164 regulates the tumorigenesis of ovarian surface epithelial cells through the SDF-1?/CXCR4 axis.
23792457 2014 CD164 and FCRL3 are highly expressed on CD4+CD26- T cells in Sézary syndrome patients.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
22409183 2012 Inhibiting CD164 expression in colon cancer cell line HCT116 leads to reduced cancer cell proliferation, mobility, and metastasis in vitro and in vivo.
More...