Property Summary

NCBI Gene PubMed Count 140
Grant Count 563
R01 Count 374
Funding $71,890,780.33
PubMed Score 1284.82
PubTator Score 473.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 3.300 0.001
psoriasis 1.500 0.000
osteosarcoma 1.712 0.001
glioblastoma 1.100 0.031
tuberculosis -1.500 0.000
lung cancer -2.600 0.000
group 3 medulloblastoma 1.100 0.017
lung carcinoma -1.300 0.000
spina bifida -1.108 0.028
acute myeloid leukemia 1.300 0.007
ulcerative colitis 1.900 0.000

Synonym

Accession Q04864 Q17RU2 Q2PNZ7 Q6LDY0
Symbols C-Rel

Gene

REL

PANTHER Protein Class (1)

 GWAS Trait (1)

Gene RIF (78)

PMID Text
26784953 The REL rs842647 polymorphism may be a susceptibility factor for Behcet's Disease pathogenesis and skin lesions.
26683819 Over-expression of nuclear NF-kappaB1 and c-Rel are strong risk factors associated with chemoresistance and the prognosis of serous epithelial ovarian cancer
26324762 analysis of c-Rel nuclear expression and REL amplification and crosstalk between c-Rel and the p53 pathway reveals prognostic roles diffuse large B-cell lymphoma
25842167 Thus, our studies support a role for c-Rel in processes crucial for keratinocyte integrity and malignant transformation such as adhesion and migration.
25472883 HIV-1 Tat specifically associates with c-Rel promoter to downregulate c-Rel expression in T cells
25299780 c-Rel is a critical mediator of NF-kappaB-dependent TRAIL resistance of pancreatic cancer cells.
25266721 c-Rel regulates Ezh2 expression in lymphocytes and malignant lymphoid cells in a novel transcriptional network
24489016 The REL SNP rs9309331 homozygous minor allele was associated with higher LDL levels in rheumatoid arthritis.
23982206 Data indicate that the NF-kappaB subunit c-Rel is modified and activated by O-GlcNAcylation.
23892589 Our studies indicate that c-Rel is a key regulator of cell fate decisions in keratinocytes such as cell growth and death and may have a role in epidermal carcinogenesis.
More...

AA Sequence

MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKND      1 - 70
PYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDI     71 - 140
EDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDK    141 - 210
VQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYL    211 - 280
PDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGL    281 - 350
LGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTP    351 - 420
RSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNM    421 - 490
LSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSD    491 - 560
AFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV               561 - 619
//

Text Mined References (147)

PMID Year Title
26972000 2016 Substrate-Trapped Interactors of PHD3 and FIH Cluster in Distinct Signaling Pathways.
26784953 2016 Genetic Variation in the REL Gene Increases Risk of Behcet's Disease in a Chinese Han Population but That of PRKCQ Does Not.
26683819 2016 Over-expression of nuclear NF-?B1 and c-Rel correlates with chemoresistance and prognosis of serous epithelial ovarian cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26324762 2015 Prognostic impact of c-Rel nuclear expression and REL amplification and crosstalk between c-Rel and the p53 pathway in diffuse large B-cell lymphoma.
25842167 2015 The c-Rel subunit of NF-?B is a crucial regulator of phenotype and motility of HaCaT keratinocytes.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25299780 2014 c-Rel is a critical mediator of NF-?B-dependent TRAIL resistance of pancreatic cancer cells.
25266721 2014 c-Rel regulates Ezh2 expression in activated lymphocytes and malignant lymphoid cells.
More...