Property Summary

NCBI Gene PubMed Count 147
PubMed Score 1339.08
PubTator Score 473.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid arthritis 3.300 1.5e-03
psoriasis 1.500 1.5e-05
acute myeloid leukemia 1.300 6.6e-03
glioblastoma 1.100 3.1e-02
group 3 medulloblastoma 1.100 1.7e-02
lung cancer -1.800 1.3e-03
lung carcinoma -1.300 1.7e-13
osteosarcoma 1.712 6.9e-04
spina bifida -1.108 2.8e-02
tuberculosis -1.500 1.1e-05
ulcerative colitis 1.900 1.6e-07

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (85)

AA Sequence

MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKND      1 - 70
PYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDI     71 - 140
EDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDK    141 - 210
VQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYL    211 - 280
PDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGL    281 - 350
LGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTP    351 - 420
RSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNM    421 - 490
LSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSD    491 - 560
AFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV               561 - 619
//

Text Mined References (154)

PMID Year Title