Property Summary

NCBI Gene PubMed Count 50
PubMed Score 56.72
PubTator Score 53.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.300 3.6e-03
breast carcinoma 1.200 1.0e-02
dermatomyositis 1.400 1.8e-03
glioblastoma 1.200 3.4e-08
group 3 medulloblastoma 1.200 1.8e-03
hepatocellular carcinoma -1.200 1.2e-02
intraductal papillary-mucinous adenoma (... 1.200 3.2e-03
intraductal papillary-mucinous carcinoma... 1.200 1.1e-02
lung cancer 1.600 3.7e-04
Multiple myeloma 2.656 1.1e-04
osteosarcoma 3.379 5.7e-08
ovarian cancer 3.400 1.8e-05
tuberculosis 1.100 1.4e-05
Waldenstrons macroglobulinemia 1.310 1.6e-02

Gene RIF (28)

AA Sequence

MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDS      1 - 70
EVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL     71 - 140
SDQTKEKE                                                                  141 - 148
//

Text Mined References (57)

PMID Year Title