Property Summary

NCBI Gene PubMed Count 43
Grant Count 7
R01 Count 2
Funding $685,423.25
PubMed Score 49.24
PubTator Score 53.22

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

PMID Text
26446790 The stimulatory effect of mtSSB on Pol gamma on these ssDNA templates is not species-specific.
26170237 This study determined that hSSB1 acetylation at K94 mediated by the acetyltransferase p300 and the deacetylases SIRT4 and HDAC10 impaired its ubiquitin-mediated degradation by proteasomes.
25762445 SSBP1 protects cells from proteotoxic stresses by potentiating stress-induced HSF1 transcriptional activity
25249620 Fbxl5 interacts with and targets hSSB1 for ubiquitination and degradation, which could be prevented by ATM-mediated hSSB1 T117 phosphorylation.
23986477 In response to the DNA damage response, INTS3-hSSB1-INTS6 complex relocates to the DNA damage sites.
23290262 mtSSB potentially prevents formation of DNA breaks in ssDNA, ensuring that base removal primarily occurs in dsDNA.
23184057 Results indicate that hSSB1 may regulate DNA damage checkpoints by positively modulating p53 and its downstream target p21.
22190034 HIV-1 Rev is identified to have a physical interaction with single-stranded DNA binding protein 1 (SSBP1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22153281 Local enrichment of UNG1 at DNA-bound mtSSB may furthermore facilitate rapid access to- and processing of the damage once the dsDNA conformation is restored.
21953457 mtSSB uses distinct structural elements to interact functionally with its mtDNA replisome partners and to promote proper mtDNA replication in animal cells
More...

AA Sequence

MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDS      1 - 70
EVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL     71 - 140
SDQTKEKE                                                                  141 - 148
//

Text Mined References (50)

PMID Year Title
26446790 2015 Mitochondrial Single-stranded DNA-binding Proteins Stimulate the Activity of DNA Polymerase ? by Organization of the Template DNA.
26170237 2015 Acetylation-dependent function of human single-stranded DNA binding protein 1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25762445 2015 Mitochondrial SSBP1 protects cells from proteotoxic stresses by potentiating stress-induced HSF1 transcriptional activity.
25249620 2014 FBXL5-mediated degradation of single-stranded DNA-binding protein hSSB1 controls DNA damage response.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23986477 2013 A core hSSB1-INTS complex participates in the DNA damage response.
23568457 2013 Genetic variants associated with disordered eating.
23290262 2013 Alkyladenine DNA glycosylase (AAG) localizes to mitochondria and interacts with mitochondrial single-stranded binding protein (mtSSB).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...