Property Summary

NCBI Gene PubMed Count 65
Grant Count 57
R01 Count 39
Funding $12,332,668.73
PubMed Score 1183.28
PubTator Score 216.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 0.000

Synonym

Accession Q04828 P52896 Q5SR15 Q7M4N2 Q9UCX2
Symbols C9
DD1
DDH
DDH1
H-37
HBAB
MBAB
HAKRC
DD1/DD2
2-ALPHA-HSD
20-ALPHA-HSD

Gene

PANTHER Protein Class (2)

PDB

1MRQ   3C3U   3GUG   3NTY   4YVP  

Gene RIF (40)

PMID Text
25816367 Activation of AKR1C1/ERbeta induces apoptosis by downregulation of c-FLIP in prostate cancer cells.
24390875 results suggest a gender-specific modulatory effect of AKR1C1 on anxiety levels, most likely through changes in progesterone and allopregnanolone levels within and outside the brain
24189185 Studies indicate that mutations in aldo-keto reductase family 1 (AKR1) enzymes AKR1C1 and AKR1C4 are responsible for sexual development dysgenesis and mutations in AKR1D1 are causative in bile-acid deficiency.
23933386 activation of the Nrf2/AKR1C axis may contribute to oxaliplatin resistance in gastric carcinoma
23183084 Which promoted significant reduction of AKR1C1 and AKR1C2 expression.
23165153 The involvement of up-regulated AKR1C1, AKR1C3 and proteasome in CDDP resistance of colon cancers.
22278827 It was concluded that the truncated E6 protein of human papillomavirus 16, known as E6*I, has a novel function in upregulating expression of human AKR1C.
22064385 Data suggest that interleukin-1beta facilitates progesterone metabolism in cervical fibroblasts by regulating expression of AKR1C1 and AKR1C2.
21521174 role of AKR1C1in the metabolism of testosterone and progesterone via the 5beta-reductase pathway.
21232532 enhanced metabolism of progesterone by SRD5A1 and the 20alpha-HSD and 3alpha/beta-HSD activities of AKR1C1, AKR1C2 and AKR1C3
More...

AA Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA      1 - 70
DGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFD     71 - 140
TVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKD    141 - 210
IVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN    211 - 280
VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY                               281 - 323
//

Text Mined References (66)

PMID Year Title
25816367 2015 Activation of AKR1C1/ER? induces apoptosis by downregulation of c-FLIP in prostate cancer cells: A prospective therapeutic opportunity.
25416956 2014 A proteome-scale map of the human interactome network.
24390875 2014 Gender-specific association of variants in the AKR1C1 gene with dimensional anxiety in patients with panic disorder: additional evidence for the importance of neurosteroids in anxiety?
24189185 2014 Role of aldo-keto reductase family 1 (AKR1) enzymes in human steroid metabolism.
23933386 2013 Gene expression profiling for analysis acquired oxaliplatin resistant factors in human gastric carcinoma TSGH-S3 cells: the role of IL-6 signaling and Nrf2/AKR1C axis identification.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23183084 2013 Progestin effects on expression of AKR1C1-AKR1C3, SRD5A1 and PGR in the Z-12 endometriotic epithelial cell line.
23165153 2013 Pathophysiological roles of aldo-keto reductases (AKR1C1 and AKR1C3) in development of cisplatin resistance in human colon cancers.
22566634 2012 The genetic architecture of economic and political preferences.
More...