Property Summary

Ligand Count 14
NCBI Gene PubMed Count 114
PubMed Score 290.93
PubTator Score 178.93

Knowledge Summary

Patent (22,078)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Heart disease 306 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.022 2.4e-04
fascioscapulohumeral muscular dystrophy 1.032 6.2e-04
group 4 medulloblastoma 1.800 8.8e-04
osteosarcoma 3.074 3.3e-07
ovarian cancer -1.500 7.2e-05
psoriasis 1.200 2.6e-03
ulcerative colitis 1.500 3.8e-08

Protein-protein Interaction (8)

Gene RIF (83)

AA Sequence

MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC      1 - 70
FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLAC     71 - 140
LLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITL    141 - 210
LECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLW    211 - 280
LITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQC    281 - 350
CIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS    351 - 420
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALR    421 - 490
IKKTLTKIDNSLDKLKTDC                                                       491 - 509
//

Text Mined References (117)

PMID Year Title