Property Summary

NCBI Gene PubMed Count 104
Grant Count 25
R01 Count 20
Funding $1,872,436.82
PubMed Score 342.55
PubTator Score 503.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.009 0.014
osteosarcoma 1.495 0.004
lung cancer 1.200 0.015
colon cancer 1.100 0.006

Gene RIF (88)

PMID Text
26711908 Data suggest Glo1's effects on anxiety-like behavior are centrally mediated as overexpression of Glo1 in neurons was sufficient to increase anxiety-like behavior
26552067 Studies indicate that the most extensively investigated The most extensively investigated glyoxalase enzymes are glyoxalase I and glyoxalase II (Glo1 and Glo2).
26298793 The GLO1 variations were not the source of association of the BTBD9 locus with restless legs syndrome.
26122242 individuals with the GLO1 A /E genotype, PON192/QR-RR genotypes and PON55/LM-MM genotypes had a significantly higher risk of cerebral cavernous malformations compared with the other genotypes.
25841781 Glo1 is involved in the Min-U-Sil 5 crystalline silica-induced BEAS-2B cell mitochondrial apoptotic pathway.
25557363 Two classes of the metalloenzyme GlxI exist and vary in their metal dependencies
25407489 Significant differences in the allelic and genotype frequencies of GLO1.
25342507 This review describes the role of GLO1 in tumor cell proliferation and survival, and the potential of GLO1 as a biomarker for tumor diagnosis and as a target for anticancer drug development. [review]
25201284 This study demonstrated that the GLO1 C332 (Ala111) allele confers autism vulnerability by reducing brain glyoxalase activity and enhancing advanced glycation end-products. formation
25184957 GLO1 is prevailingly expressed in cutaneous neoplasms of higher malignancy and contributes to the progression of squamous cell carcinoma
More...

AA Sequence

MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSL      1 - 70
YFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACK     71 - 140
RFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM                              141 - 184
//

Text Mined References (113)

PMID Year Title
26711908 2016 Neuronal overexpression of Glo1 or amygdalar microinjection of methylglyoxal is sufficient to regulate anxiety-like behavior in mice.
26552067 2015 Glyoxalase biochemistry.
26298793 2015 Analysis of functional GLO1 variants in the BTBD9 locus and restless legs syndrome.
26122242 GLYOXALASE I A111E, PARAOXONASE 1 Q192R AND L55M POLYMORPHISMS IN ITALIAN PATIENTS WITH SPORADIC CEREBRAL CAVERNOUS MALFORMATIONS: A PILOT STUDY.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25841781 2015 Peroxynitrite-mediated glyoxalase I epigenetic inhibition drives apoptosis in airway epithelial cells exposed to crystalline silica via a novel mechanism involving argpyrimidine-modified Hsp70, JNK, and NF-?B.
25557363 2015 Modulating glyoxalase I metal selectivity by deletional mutagenesis: underlying structural factors contributing to nickel activation profiles.
25407489 2015 Polymorphisms of the receptor for advanced glycation end-products and glyoxalase I in patients with renal cancer.
25342507 2014 Glyoxalase I in tumor cell proliferation and survival and as a potential target for anticancer therapy.
25201284 2014 The GLO1 C332 (Ala111) allele confers autism vulnerability: family-based genetic association and functional correlates.
More...