Property Summary

NCBI Gene PubMed Count 166
PubMed Score 9.41
PubTator Score 96.03

Knowledge Summary

Patent (4,999)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 1.63059047704351E-239
lung carcinoma 2844 2.52087885933667E-29
non-small cell lung cancer 2798 4.05229942506434E-22
ovarian cancer 8492 1.46429970618541E-7
lung adenocarcinoma 2714 1.72420509352123E-6
group 3 medulloblastoma 2254 9.2927950867823E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.1752853007799E-4
cutaneous lupus erythematosus 1056 4.8532995176443E-4
osteosarcoma 7933 8.58548114701066E-4
medulloblastoma, large-cell 6234 9.81672694791849E-4
Pick disease 1893 0.00182321858857755
lung cancer 4473 0.00343376264846105
ependymoma 2514 0.0050474742504445
oligodendroglioma 2849 0.00634020733646205
astrocytic glioma 2241 0.00650235985916036
primitive neuroectodermal tumor 3031 0.00892532030733988
primary Sjogren syndrome 789 0.00910071184544151
interstitial cystitis 2299 0.00993642604437185
subependymal giant cell astrocytoma 2287 0.0250126457289721
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Type 1 diabetes mellitus 104 0.0 2.0
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 3.078 1.5

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.100 0.007
ependymoma -1.600 0.005
oligodendroglioma -1.300 0.006
psoriasis 2.900 0.000
cutaneous lupus erythematosus 2.900 0.000
osteosarcoma -2.418 0.001
group 3 medulloblastoma -2.800 0.000
medulloblastoma, large-cell -1.600 0.001
primitive neuroectodermal tumor -1.500 0.009
non-small cell lung cancer -1.788 0.000
intraductal papillary-mucinous carcinoma... -1.300 0.000
lung cancer 2.800 0.003
interstitial cystitis 1.200 0.010
primary Sjogren syndrome 1.100 0.009
subependymal giant cell astrocytoma -1.403 0.025
lung adenocarcinoma -1.110 0.000
lung carcinoma -2.300 0.000
Pick disease -1.200 0.002
ovarian cancer 1.400 0.000

Synonym

Accession Q04759 B4DF52 Q14DH6 Q3MJF1 Q64FY5 Q9H508 Q9H549
Symbols PRKCT
nPKC-theta

Gene

PDB

1XJD   2ENJ   2ENN   2ENZ   2JED   4Q9Z   4RA5   5F9E  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (134)

PMID Text
26784953 The PRKCQ polymorphism is not associated with Behcet's Disease.
26390157 Sumoylation of PKC-theta; was essential for T cell activation. Desumoylation did not affect the catalytic activity of PKC-theta; but inhibited the association of CD28 with PKC-theta; and filamin A and impaired the assembly of a mature immunological synapse.
26298773 Data show that tonantzitlolone (TZL) was able to induce protein kinase c theta (PKCtheta;)-dependent heat shock transcription factor 1 (HSF1)phosphorylation.
25889880 Together, these findings both in Jurkat T cells as well as in primary T cells indicate a regulatory role of Coro1A on PKCtheta; recruitment and function downstream of the TCR leading to NF-kappaB transactivation.
25827954 PKCtheta; acts through the activation of p38 MAPK and autophagy induction. PKCtheta; acts through the activation of p38 MAPK and autophagy induction to induce the Epstein-Barr virus (EBV) lytic cycle.
25000588 Data suggest that protein kinase C theta (PKCtheta;) inhibition alone may be sufficient to drive efficacy in chronic autoimmune and inflammatory diseases.
24979806 Diacylglycerol activation of protein kinase Ctheta; and subsequent impairment of insulin signaling plays a major role in the pathogenesis of muscle insulin resistance in humans.
24891615 protein kinase C-theta promotes Epithelial to mesenchymal transition by acting as a critical chromatin-anchored switch for inducible genes via transforming growth factor beta and the key inflammatory regulatory protein NF-kappaB.
24250818 responsive to chemokine induced migration and are defective in migration to lymph nodes. Our results reveal a novel role for PKCtheta; in regulating T cell migration
23862765 The results show that PKC-theta; has important diagnostic significance in gastrointestinal stromal tumors.
More...

AA Sequence

MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVM      1 - 70
QIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFF     71 - 140
ALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCT    141 - 210
GSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANL    211 - 280
CGINQKLMAEALAMIESTQQARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPL    281 - 350
DEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD    351 - 420
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIIL    421 - 490
GLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSV    491 - 560
DWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQ    561 - 630
HPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPG    631 - 700
MERLIS                                                                    701 - 706
//

Text Mined References (186)

PMID Year Title
26784953 2016 Genetic Variation in the REL Gene Increases Risk of Behcet's Disease in a Chinese Han Population but That of PRKCQ Does Not.
26390157 2015 TCR-induced sumoylation of the kinase PKC-? controls T cell synapse organization and T cell activation.
26298773 2015 Tonantzitlolone cytotoxicity toward renal cancer cells is PKC?- and HSF1-dependent.
25889880 2015 Novel protein kinase C ?: coronin 1A complex in T lymphocytes.
25827954 2015 PKC theta and p38 MAPK activate the EBV lytic cycle through autophagy induction.
25000588 2015 Discovery of selective and orally bioavailable protein kinase C? (PKC?) inhibitors from a fragment hit.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24979806 2014 Role of diacylglycerol activation of PKC? in lipid-induced muscle insulin resistance in humans.
24891615 2014 Chromatinized protein kinase C-? directly regulates inducible genes in epithelial to mesenchymal transition and breast cancer stem cells.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
More...