Property Summary

NCBI Gene PubMed Count 166
PubMed Score 9.41
PubTator Score 96.03

Knowledge Summary

Patent (4,999)

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.100 0.007
ependymoma -1.600 0.005
oligodendroglioma -1.300 0.006
psoriasis 2.900 0.000
cutaneous lupus erythematosus 2.900 0.000
osteosarcoma -2.418 0.001
group 3 medulloblastoma -2.800 0.000
medulloblastoma, large-cell -1.600 0.001
primitive neuroectodermal tumor -1.500 0.009
non-small cell lung cancer -1.788 0.000
intraductal papillary-mucinous carcinoma... -1.300 0.000
lung cancer 2.800 0.003
interstitial cystitis 1.200 0.010
primary Sjogren syndrome 1.100 0.009
subependymal giant cell astrocytoma -1.403 0.025
lung adenocarcinoma -1.110 0.000
lung carcinoma -2.300 0.000
Pick disease -1.200 0.002
ovarian cancer 1.400 0.000

Synonym

Accession Q04759 B4DF52 Q14DH6 Q3MJF1 Q64FY5 Q9H508 Q9H549
Symbols PRKCT
nPKC-theta

Gene

PDB

1XJD   2ENJ   2ENN   2ENZ   2JED   4Q9Z   4RA5   5F9E  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (136)

PMID Text
26784953 The PRKCQ polymorphism is not associated with Behcet's Disease.
26390157 Sumoylation of PKC-theta; was essential for T cell activation. Desumoylation did not affect the catalytic activity of PKC-theta; but inhibited the association of CD28 with PKC-theta; and filamin A and impaired the assembly of a mature immunological synapse.
26298773 Data show that tonantzitlolone (TZL) was able to induce protein kinase c theta (PKCtheta;)-dependent heat shock transcription factor 1 (HSF1)phosphorylation.
25889880 Together, these findings both in Jurkat T cells as well as in primary T cells indicate a regulatory role of Coro1A on PKCtheta; recruitment and function downstream of the TCR leading to NF-kappaB transactivation.
25827954 PKCtheta; acts through the activation of p38 MAPK and autophagy induction. PKCtheta; acts through the activation of p38 MAPK and autophagy induction to induce the Epstein-Barr virus (EBV) lytic cycle.
25000588 Data suggest that protein kinase C theta (PKCtheta;) inhibition alone may be sufficient to drive efficacy in chronic autoimmune and inflammatory diseases.
24979806 Diacylglycerol activation of protein kinase Ctheta; and subsequent impairment of insulin signaling plays a major role in the pathogenesis of muscle insulin resistance in humans.
24891615 protein kinase C-theta promotes Epithelial to mesenchymal transition by acting as a critical chromatin-anchored switch for inducible genes via transforming growth factor beta and the key inflammatory regulatory protein NF-kappaB.
24250818 responsive to chemokine induced migration and are defective in migration to lymph nodes. Our results reveal a novel role for PKCtheta; in regulating T cell migration
23862765 The results show that PKC-theta; has important diagnostic significance in gastrointestinal stromal tumors.
More...

AA Sequence

MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVM      1 - 70
QIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFF     71 - 140
ALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCT    141 - 210
GSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANL    211 - 280
CGINQKLMAEALAMIESTQQARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPL    281 - 350
DEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD    351 - 420
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIIL    421 - 490
GLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSV    491 - 560
DWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQ    561 - 630
HPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPG    631 - 700
MERLIS                                                                    701 - 706
//

Text Mined References (186)

PMID Year Title
26784953 2016 Genetic Variation in the REL Gene Increases Risk of Behcet's Disease in a Chinese Han Population but That of PRKCQ Does Not.
26390157 2015 TCR-induced sumoylation of the kinase PKC-? controls T cell synapse organization and T cell activation.
26298773 2015 Tonantzitlolone cytotoxicity toward renal cancer cells is PKC?- and HSF1-dependent.
25889880 2015 Novel protein kinase C ?: coronin 1A complex in T lymphocytes.
25827954 2015 PKC theta and p38 MAPK activate the EBV lytic cycle through autophagy induction.
25000588 2015 Discovery of selective and orally bioavailable protein kinase C? (PKC?) inhibitors from a fragment hit.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24979806 2014 Role of diacylglycerol activation of PKC? in lipid-induced muscle insulin resistance in humans.
24891615 2014 Chromatinized protein kinase C-? directly regulates inducible genes in epithelial to mesenchymal transition and breast cancer stem cells.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
More...