Property Summary

NCBI Gene PubMed Count 24
Grant Count 26
R01 Count 12
Funding $2,888,390.38
PubMed Score 87.31
PubTator Score 47.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

Gene RIF (9)

PMID Text
25998175 Based upon ethnicity-stratified single-variant association analysis and trans-ethnic meta-analysis of 6201 participants of the Multi-Ethnic Study of Atherosclerosis, discovered 5 common and low-frequency variants: HGF missense polymorphism rs5745687 (p.E299K) and 4 variants (rs16844364, rs4690098, rs114303452, rs3748034) within or in proximity to HGFAC.[Meta-analysis]
20424473 Observational study of gene-disease association. (HuGE Navigator)
19456860 Results suggest that hepatocyte growth factor activator is a major serum activator of pro-macrophage-stimulating protein.
18691255 the activated form of HGFA is present at high levels in serum and bone marrow of myeloma patients, thus providing a necessary prerequisite for the activation of HGF.
18422749 Induction of hepatocyte growth factor activator gene expression under hypoxia activates the hepatocyte growth factor/c-Met system via hypoxia inducible factor-1 in pancreatic cancer.
18221492 KLK4 and KLK5 activate pro-HGFA.
16189274 HGF/MET signaling and aberrant HGF-activator expression is associated with diffuse large B-cell lymphoma
15172968 the HGF-activator has a role in multiple myeloma cells' catalysis of hepatocyte growth factor (HGF) activation
11013244 HAI-1 (serine peptidase inhibitor, Kunitz type 1) specifically traps active form of HGF activator on cellular surface and regulates HGF activation in pericellular microenvironment.

AA Sequence

MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTILVTSVTSETPAT      1 - 70
SAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLHACTSEGSAHRKWCATTHNYD     71 - 140
RDRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQDPQSYHCSCPRAFTGKDCGTEKCFDETRYEY    141 - 210
LEGGDRWARVRQGHVEQCECFGGRTWCEGTRHTACLSSPCLNGGTCHLIVATGTTVCACPPGFAGRLCNI    211 - 280
EPDERCFLGNGTGYRGVASTSASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCY    281 - 350
VVKDSALSWEYCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHP    351 - 420
WLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSV    421 - 490
FNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVP    491 - 560
LVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGV    561 - 630
YTRVANYVDWINDRIRPPRRLVAPS                                                 631 - 655
//

Text Mined References (28)

PMID Year Title
25998175 2015 Trans-ethnic meta-analysis identifies common and rare variants associated with hepatocyte growth factor levels in the Multi-Ethnic Study of Atherosclerosis (MESA).
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
19456860 2009 Hepatocyte growth factor activator is a serum activator of single-chain precursor macrophage-stimulating protein.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18691255 2008 Elevated serum concentrations of activated hepatocyte growth factor activator in patients with multiple myeloma.
18422749 2008 Induction of hepatocyte growth factor activator gene expression under hypoxia activates the hepatocyte growth factor/c-Met system via hypoxia inducible factor-1 in pancreatic cancer.
18221492 2008 Activation of hepatocyte growth factor activator zymogen (pro-HGFA) by human kallikrein 1-related peptidases.
18077410 2007 Structural insight into distinct mechanisms of protease inhibition by antibodies.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
More...