Property Summary

NCBI Gene PubMed Count 35
Grant Count 41
R01 Count 22
Funding $5,343,619.64
PubMed Score 107.11
PubTator Score 66.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
nephrosclerosis -1.234 0.007
astrocytic glioma -2.500 0.012
ependymoma -3.500 0.004
psoriasis -2.100 0.000
cutaneous lupus erythematosus -1.300 0.023
glioblastoma -2.700 0.024
oligodendroglioma -1.300 0.000
osteosarcoma -1.536 0.022
atypical teratoid / rhabdoid tumor -2.400 0.014
medulloblastoma -3.800 0.000
primitive neuroectodermal tumor -3.000 0.015
Atopic dermatitis -1.800 0.001
lung cancer 6.700 0.000
interstitial cystitis -1.800 0.000
pediatric high grade glioma -2.100 0.024
pilocytic astrocytoma -2.800 0.000
Pick disease 1.400 0.007
ductal carcinoma in situ -1.800 0.000
invasive ductal carcinoma -1.800 0.002
ovarian cancer 1.700 0.023
Down syndrome 1.100 0.027

Gene RIF (21)

PMID Text
26132438 EMX2 expression was down-regulated in lung SCC tissue compared to matched adjacent normal tissue. EMX2 expression was associated with improved overall survival. Knockdown promoted chemo-resistance and cell migration.
25577462 Although it is uncommon (0.19%), EMX2 is the first gene identified that if perturbed may cause isolated incomplete mullerian fusion.
25023662 EMX2 expression is downregulated in advanced cases of malignant pleural mesothelioma and may serve as an important prognostic and predictive molecular biomarker of progression-free survival.
24975717 Deletions of EMX2 have been associated with a wide range of DSD.
23370654 downregulation of empty spiracles homeobox 2 (EMX2) was associated with tumor progression and may be a critical factor in the carcinogenesis and progression of endometrial cancer
23029345 EMX2 expression led to inhibition of cell proliferation and Wnt signaling pathway both in vitro and in a gastric cancer xenograft model in vivo.
21917011 Study analyzed mutations of EMX2 gene in 45 prostate carcinomas, 51 non-small cell lung cancers, 43 gastric carcinomas, 44 colorectal carcinomas, and 43 breast carcinomas by polymerase chain reaction and single-strand conformation polymorphism assay.
21726823 Downregulation of EMX2 is associated with clinical outcomes in lung adenocarcinoma.
21651764 Data show that human teneurin-1 is directly regulated by EMX2 at a conserved promoter region upstream of the transcription start site, and identify and characterize the EMX2 dependent promoter element of human teneurin-1.
20697358 promoter. Restoration of EMX2 expression in lung cancer cells lacking endogenous EMX2 expression suppressed cell proliferation and invasive phenotypes
More...

AA Sequence

MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLV      1 - 70
FAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTS     71 - 140
PESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFK    141 - 210
RQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD                                211 - 252
//

Text Mined References (36)

PMID Year Title
26132438 2015 EMX2 Is a Predictive Marker for Adjuvant Chemotherapy in Lung Squamous Cell Carcinomas.
25577462 2015 Nonsense mutation of EMX2 is potential causative for uterus didelphysis: first molecular explanation for isolated incomplete müllerian fusion.
25023662 2014 The homeobox gene EMX2 is a prognostic and predictive marker in malignant pleural mesothelioma.
24975717 2014 Severe sex differentiation disorder in a boy with a 3.8 Mb 10q25.3-q26.12 microdeletion encompassing EMX2.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23541324 2013 Genome-wide association study identifies TH1 pathway genes associated with lung function in asthmatic patients.
23370654 2013 EMX2 is downregulated in endometrial cancer and correlated with tumor progression.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23029345 2012 Adenoviral delivery of the EMX2 gene suppresses growth in human gastric cancer.
More...