Property Summary

NCBI Gene PubMed Count 37
PubMed Score 110.78
PubTator Score 66.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Schizencephaly 4

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -2.500 1.2e-02
Astrocytoma, Pilocytic -2.700 5.1e-04
Atopic dermatitis -1.800 5.9e-04
atypical teratoid / rhabdoid tumor -2.400 1.4e-02
cutaneous lupus erythematosus -1.300 2.3e-02
Down syndrome 1.100 2.7e-02
ductal carcinoma in situ -1.800 5.0e-04
ependymoma -3.500 3.7e-03
glioblastoma -1.500 4.1e-02
group 4 medulloblastoma -3.400 8.5e-04
interstitial cystitis -1.700 1.8e-03
invasive ductal carcinoma -1.800 2.5e-03
lung cancer 4.400 1.4e-05
nephrosclerosis -1.234 7.0e-03
oligodendroglioma -1.300 7.9e-06
osteosarcoma -1.536 2.2e-02
ovarian cancer 1.700 2.3e-02
pediatric high grade glioma -2.100 2.4e-02
Pick disease 1.400 7.4e-03
primitive neuroectodermal tumor -3.000 1.5e-02
psoriasis -2.100 1.4e-07

Gene RIF (23)

AA Sequence

MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLV      1 - 70
FAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTS     71 - 140
PESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFK    141 - 210
RQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD                                211 - 252
//

Text Mined References (38)

PMID Year Title