Property Summary

NCBI Gene PubMed Count 27
PubMed Score 30.34
PubTator Score 23.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.8e-02
Breast cancer -1.400 4.3e-68
chronic lymphosyte leukemia 1.100 2.3e-04
colon cancer -1.400 5.4e-03
cystic fibrosis -1.276 3.1e-03
ependymoma 2.100 2.3e-02
glioblastoma 1.300 1.7e-02
invasive ductal carcinoma -1.100 2.3e-03
lung cancer -1.700 1.3e-03
lung carcinoma -1.900 8.4e-39
Polycystic ovary syndrome -1.447 3.7e-03
primitive neuroectodermal tumor 1.200 1.7e-02

Protein-protein Interaction (7)

Gene RIF (12)

AA Sequence

MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMY      1 - 70
YEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHLSH     71 - 140
GHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPS    141 - 210
ASFRGAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLD    211 - 280
KTRLLKKDAPISPASIASSSSTPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKP    281 - 350
PGVDPLASSLRTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP    351 - 420
VVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVV    421 - 490
CAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIW    491 - 560
DLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISND    561 - 630
GTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLH    631 - 700
ESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYE    701 - 770
VIY                                                                       771 - 773
//

Text Mined References (40)

PMID Year Title