Property Summary

NCBI Gene PubMed Count 25
Grant Count 18
R01 Count 10
Funding $924,644.18
PubMed Score 29.82
PubTator Score 23.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma 2.100 0.023
chronic lymphosyte leukemia 1.100 0.000
cystic fibrosis -1.276 0.003
atypical teratoid / rhabdoid tumor 1.400 0.008
glioblastoma 1.300 0.017
primitive neuroectodermal tumor 1.200 0.017
lung cancer -1.700 0.001
colon cancer -1.400 0.005
Polycystic Ovary Syndrome -1.447 0.004
lung carcinoma -1.900 0.000
Breast cancer -1.400 0.000
invasive ductal carcinoma -1.100 0.002

 GWAS Trait (1)

Gene RIF (11)

PMID Text
26701208 the results suggested that TLE4, a potential prognostic biomarker for colorectal cancer, plays an important role in the development and progression of human colorectal cancer.
25631048 PPM1B interacts with Groucho 4 and is localized to DNA in a Groucho-dependent manner, and phosphatase activity is required for transcriptional silencing.
24099773 Groucho related gene Grg4 robustly activates the expression of a BMP reporter gene, as well as enhancing and sustaining the upregulation of the endogenous Id1 gene induced by BMP7.
22927467 Displacing coactivators CREB-binding protein/p300 while promoting the recruitment of a corepressor, Grg4.
22169276 Grg4 recruits the arginine methyltransferase PRMT5 to chromatin resulting in symmetric H4R3 dimethylation.
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20816195 Observational study of gene-disease association. (HuGE Navigator)
19893608 germ cell-specific RBMY and hnRNP G-T proteins were more efficient in stimulating TLE4-T incorporation than somatically expressed hnRNP G protein.
19714205 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18258796 Knockdown of TLE1 or TLE4 levels increased the rate of cell division of the AML1-ETO-expressing Kasumi-1 cell line, whereas forced expression of either TLE1 or TLE4 caused apoptosis and cell death.
More...

AA Sequence

MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMY      1 - 70
YEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHLSH     71 - 140
GHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPS    141 - 210
ASFRGAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLD    211 - 280
KTRLLKKDAPISPASIASSSSTPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKP    281 - 350
PGVDPLASSLRTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP    351 - 420
VVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVV    421 - 490
CAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIW    491 - 560
DLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISND    561 - 630
GTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLH    631 - 700
ESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYE    701 - 770
VIY                                                                       771 - 773
//

Text Mined References (38)

PMID Year Title
26701208 2016 TLE4 promotes colorectal cancer progression through activation of JNK/c-Jun signaling pathway.
25631048 2015 The Groucho-associated phosphatase PPM1B displaces Pax transactivation domain interacting protein (PTIP) to switch the transcription factor Pax2 from a transcriptional activator to a repressor.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24676634 2014 Mutations in PAX2 associate with adult-onset FSGS.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24099773 2013 The Groucho protein Grg4 suppresses Smad7 to activate BMP signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22927467 2012 SUMOylated SoxE factors recruit Grg4 and function as transcriptional repressors in the neural crest.
22304967 2012 XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling.
More...