Property Summary

NCBI Gene PubMed Count 25
PubMed Score 29.82
PubTator Score 23.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
Breast cancer 3099 4.31702134678837E-68
lung carcinoma 2844 8.43295356498305E-39
chronic lymphosyte leukemia 232 2.30205764945326E-4
lung cancer 4473 0.00127161729708323
invasive ductal carcinoma 2950 0.00234768474765354
cystic fibrosis 1670 0.00311582379988936
Polycystic Ovary Syndrome 335 0.0036516899970162
colon cancer 1475 0.00544267309735013
atypical teratoid / rhabdoid tumor 4369 0.00827331170013677
glioblastoma 5572 0.0165706733714145
primitive neuroectodermal tumor 3031 0.0173721507928515
ependymoma 2514 0.0230510060153115
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 1.0

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma 2.100 0.023
chronic lymphosyte leukemia 1.100 0.000
cystic fibrosis -1.276 0.003
atypical teratoid / rhabdoid tumor 1.400 0.008
glioblastoma 1.300 0.017
primitive neuroectodermal tumor 1.200 0.017
lung cancer -1.700 0.001
colon cancer -1.400 0.005
Polycystic Ovary Syndrome -1.447 0.004
lung carcinoma -1.900 0.000
Breast cancer -1.400 0.000
invasive ductal carcinoma -1.100 0.002

Synonym

Accession Q04727 F8W6T6 Q3ZCS1 Q5T1Y2 Q6PCB3 Q9BZ07 Q9BZ08 Q9BZ09 Q9NSL3 Q9ULF9
Symbols ESG
BCE1
ESG4
GRG4
BCE-1
Grg-4
E(spI)

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (11)

PMID Text
26701208 the results suggested that TLE4, a potential prognostic biomarker for colorectal cancer, plays an important role in the development and progression of human colorectal cancer.
25631048 PPM1B interacts with Groucho 4 and is localized to DNA in a Groucho-dependent manner, and phosphatase activity is required for transcriptional silencing.
24099773 Groucho related gene Grg4 robustly activates the expression of a BMP reporter gene, as well as enhancing and sustaining the upregulation of the endogenous Id1 gene induced by BMP7.
22927467 Displacing coactivators CREB-binding protein/p300 while promoting the recruitment of a corepressor, Grg4.
22169276 Grg4 recruits the arginine methyltransferase PRMT5 to chromatin resulting in symmetric H4R3 dimethylation.
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20816195 Observational study of gene-disease association. (HuGE Navigator)
19893608 germ cell-specific RBMY and hnRNP G-T proteins were more efficient in stimulating TLE4-T incorporation than somatically expressed hnRNP G protein.
19714205 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18258796 Knockdown of TLE1 or TLE4 levels increased the rate of cell division of the AML1-ETO-expressing Kasumi-1 cell line, whereas forced expression of either TLE1 or TLE4 caused apoptosis and cell death.
More...

AA Sequence

MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMY      1 - 70
YEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHLSH     71 - 140
GHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPS    141 - 210
ASFRGAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLD    211 - 280
KTRLLKKDAPISPASIASSSSTPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKP    281 - 350
PGVDPLASSLRTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP    351 - 420
VVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVV    421 - 490
CAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIW    491 - 560
DLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISND    561 - 630
GTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLH    631 - 700
ESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYE    701 - 770
VIY                                                                       771 - 773
//

Text Mined References (38)

PMID Year Title
26701208 2016 TLE4 promotes colorectal cancer progression through activation of JNK/c-Jun signaling pathway.
25631048 2015 The Groucho-associated phosphatase PPM1B displaces Pax transactivation domain interacting protein (PTIP) to switch the transcription factor Pax2 from a transcriptional activator to a repressor.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24676634 2014 Mutations in PAX2 associate with adult-onset FSGS.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24099773 2013 The Groucho protein Grg4 suppresses Smad7 to activate BMP signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22927467 2012 SUMOylated SoxE factors recruit Grg4 and function as transcriptional repressors in the neural crest.
22304967 2012 XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling.
More...