Property Summary

NCBI Gene PubMed Count 32
Grant Count 31
R01 Count 7
Funding $3,329,687.34
PubMed Score 32.90
PubTator Score 18.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
psoriasis 1.600 0.001
osteosarcoma -2.208 0.000
astrocytoma 1.200 0.005
glioblastoma 1.100 0.001
non-small cell lung cancer 1.012 0.000
lung cancer 1.200 0.045
interstitial cystitis 1.100 0.000
group 3 medulloblastoma 1.200 0.005
acute myeloid leukemia 1.100 0.004
pituitary cancer -2.100 0.000

Gene RIF (6)

PMID Text
25249007 Increased adipose tissue (AT) TLE3 in subjects with type 2 diabetes and in AT from high fat diet and PPARgamma knockout mice suggest that TLE3 may play an adaptive regulatory role that improves AT function under decreased PPARgamma expression
24444608 induction of TLE3 by Wnt signaling is part of a negative feedback loop active during osteoblast differentiation
22194527 High TLE3 expression predicts a favorable response to taxane containing chemotherapy regimens in ovarian carcinoma.
22050093 A lack of TLE3 expression in cutaneous angiosarcoma may reflect differing pathogenesis.
20181723 Studies suggest that TLE1 and TLE3 might also play roles independent of HESX1 by interacting with other transcription factors like PROP1.
18273443 results demonstrate that different isoforms of TLE genes are commonly transcribed in human tissues and suggest that TLE3 could be involved in prostate cancer development

AA Sequence

MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYG      1 - 70
LNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQQQLQAQHLSHATHGP     71 - 140
PVQLPPHPSGLQPPGIPPVTGSSSGLLALGALGSQAHLTVKDEKNHHELDHRERESSANNSVSPSESLRA    141 - 210
SEKHRGSADYSMEAKKRKAEEKDSLSRYDSDGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARSLK    211 - 280
KDAPTSPASVASSSSTPSSKTKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPI    281 - 350
GIMASALRTPISITSSYAAPFAMMSHHEMNGSLTSPGAYAGLHNIPPQMSAAAAAAAAAYGRSPMVSFGA    351 - 420
VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVC    421 - 490
AVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWD    491 - 560
LASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDG    561 - 630
TKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHE    631 - 700
SCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEV    701 - 770
IY                                                                        771 - 772
//

Text Mined References (45)

PMID Year Title
26235987 2015 Mutations in TBX18 Cause Dominant Urinary Tract Malformations via Transcriptional Dysregulation of Ureter Development.
25249007 2015 Transducin-like enhancer of split 3 (TLE3) in adipose tissue is increased in situations characterized by decreased PPAR? gene expression.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24444608 2014 Expression of TLE3 by bone marrow stromal cells is regulated by canonical Wnt signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22304967 2012 XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling.
22194527 2012 TLE3 expression is associated with sensitivity to taxane treatment in ovarian carcinoma.
More...