Property Summary

NCBI Gene PubMed Count 34
PubMed Score 35.41
PubTator Score 18.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia 1.100 4.4e-03
astrocytoma 1.200 5.2e-03
glioblastoma 1.100 6.1e-04
group 3 medulloblastoma 1.100 2.4e-02
interstitial cystitis 1.100 8.9e-05
lung cancer 1.200 4.5e-02
malignant mesothelioma -1.500 1.2e-05
non-small cell lung cancer 1.012 3.1e-14
osteosarcoma -1.135 6.9e-03
pituitary cancer -1.500 2.7e-07
psoriasis 1.500 2.2e-08

Gene RIF (8)

AA Sequence

MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYG      1 - 70
LNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQQQLQAQHLSHATHGP     71 - 140
PVQLPPHPSGLQPPGIPPVTGSSSGLLALGALGSQAHLTVKDEKNHHELDHRERESSANNSVSPSESLRA    141 - 210
SEKHRGSADYSMEAKKRKAEEKDSLSRYDSDGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARSLK    211 - 280
KDAPTSPASVASSSSTPSSKTKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPI    281 - 350
GIMASALRTPISITSSYAAPFAMMSHHEMNGSLTSPGAYAGLHNIPPQMSAAAAAAAAAYGRSPMVSFGA    351 - 420
VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVC    421 - 490
AVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWD    491 - 560
LASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDG    561 - 630
TKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHE    631 - 700
SCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEV    701 - 770
IY                                                                        771 - 772
//

Text Mined References (47)

PMID Year Title